Property Summary

NCBI Gene PubMed Count 19
PubMed Score 60.31
PubTator Score 24.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -2.000 3.5e-05
astrocytoma -1.600 1.3e-24
Astrocytoma, Pilocytic -2.500 1.3e-10
atypical teratoid / rhabdoid tumor -2.100 1.9e-10
ependymoma -1.300 2.8e-03
glioblastoma -2.100 6.2e-11
group 3 medulloblastoma -1.200 4.3e-02
lung carcinoma 3.400 1.4e-50
medulloblastoma, large-cell -1.300 2.2e-04
oligodendroglioma -1.600 4.2e-20
osteosarcoma 1.152 2.5e-06
ovarian cancer -1.100 9.8e-05
pituitary cancer -1.900 7.8e-06
primitive neuroectodermal tumor -1.400 5.7e-04

Gene RIF (8)

AA Sequence

MYRDPEAASPGAPSRDVLLVSAIITVSLSVTVVLCGLCHWCQRKLGKRYKNSLETVGTPDSGRGRSEKKA      1 - 70
IKLPAGGKAVNTAPVPGQTPHDESDRRTEPRSSVSDLVNSLTSEMLMLSPGSEEDEAHEGCSRENLGRIQ     71 - 140
FSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFP    141 - 210
YEKVVQRILYLQVLDYDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGSGSRGELLLSLCYNPSA    211 - 280
NSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETT    281 - 350
IIITVMDKDKLSRNDVIGKIYLSWKSGPGEVKHWKDMIARPRQPVAQWHQLKA                     351 - 403
//

Text Mined References (24)

PMID Year Title