Property Summary

NCBI Gene PubMed Count 16
Grant Count 58
R01 Count 29
Funding $4,799,318.85
PubMed Score 48.40
PubTator Score 24.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
posterior fossa group B ependymoma -1.900 0.000
astrocytoma -1.600 0.000
glioblastoma -2.100 0.000
oligodendroglioma -1.600 0.000
osteosarcoma 1.152 0.000
group 4 medulloblastoma -2.300 0.000
atypical teratoid/rhabdoid tumor -2.400 0.000
medulloblastoma, large-cell -1.300 0.000
primitive neuroectodermal tumor -1.400 0.001
pediatric high grade glioma -2.200 0.000
pilocytic astrocytoma -2.500 0.000
lung carcinoma 3.400 0.000
ovarian cancer -1.100 0.000
pituitary cancer -1.900 0.000

Synonym

Accession O43581 F5GZC2 F5GZU9 F5H126 F5H1N2 F5H6C1 Q08AH6
Symbols IPCA7
IPCA-7
SYTVII
PCANAP7
SYT-VII

Gene

PDB

2D8K  

Gene RIF (5)

PMID Text
25437758 the results suggest that the two C2 domains of Syt7 bind independently to planar membranes, in contrast to reported interdomain cooperativity in Syt1
22966849 The membrane dissociation of SYT7 C2A domain but not SYT1 C2A domain is slowed by Na(2)SO(4) and trehalose, solutes that enhance the hydrophobic effect.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
12071850 identified the conserved alternative splicing events in the spacer domain of Syt VII; also shown that Syt VIIa-GFP is mainly localized in the perinuclear region and tips of neurites (dense-core vesicles), and not in the plasma membrane

AA Sequence

MYRDPEAASPGAPSRDVLLVSAIITVSLSVTVVLCGLCHWCQRKLGKRYKNSLETVGTPDSGRGRSEKKA      1 - 70
IKLPAGGKAVNTAPVPGQTPHDESDRRTEPRSSVSDLVNSLTSEMLMLSPGSEEDEAHEGCSRENLGRIQ     71 - 140
FSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFP    141 - 210
YEKVVQRILYLQVLDYDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGSGSRGELLLSLCYNPSA    211 - 280
NSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETT    281 - 350
IIITVMDKDKLSRNDVIGKIYLSWKSGPGEVKHWKDMIARPRQPVAQWHQLKA                     351 - 403
//

Text Mined References (21)

PMID Year Title
26333120 2015 Membrane Docking of the Synaptotagmin 7 C2A Domain: Computation Reveals Interplay between Electrostatic and Hydrophobic Contributions.
26322740 2015 Membrane Docking of the Synaptotagmin 7 C2A Domain: Electron Paramagnetic Resonance Measurements Show Contributions from Two Membrane Binding Loops.
25437758 2014 Lateral diffusion of proteins on supported lipid bilayers: additive friction of synaptotagmin 7 C2A-C2B tandem domains.
25416956 2014 A proteome-scale map of the human interactome network.
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22966849 2012 Hydrophobic contributions to the membrane docking of synaptotagmin 7 C2A domain: mechanistic contrast between isoforms 1 and 7.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
More...