Property Summary

NCBI Gene PubMed Count 39
PubMed Score 26.70
PubTator Score 35.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma 2.000 5.3e-03
ependymoma 1.200 4.3e-03
glioblastoma multiforme 1.100 1.3e-19
intraductal papillary-mucinous adenoma (... 2.500 3.2e-04
intraductal papillary-mucinous carcinoma... 1.500 2.0e-03
intraductal papillary-mucinous neoplasm ... 1.400 3.3e-02
lung cancer 1.100 1.0e-02
medulloblastoma, large-cell -1.500 9.9e-04
oligodendroglioma 1.200 1.0e-03
osteosarcoma -1.147 6.7e-03
ovarian cancer -1.200 6.7e-14
Pick disease 1.300 8.6e-05
ulcerative colitis -1.455 3.6e-02

Gene RIF (28)

AA Sequence

MRGAGPSPRQSPRTLRPDPGPAMSFFRRKVKGKEQEKTSDVKSIKASISVHSPQKSTKNHALLEAAGPSH      1 - 70
VAINAISANMDSFSSSRTATLKKQPSHMEAAHFGDLGRSCLDYQTQETKSSLSKTLEQVLHDTIVLPYFI     71 - 140
QFMELRRMEHLVKFWLEAESFHSTTWSRIRAHSLNTVKQSSLAEPVSPSKKHETTASFLTDSLDKRLEDS    141 - 210
GSAQLFMTHSEGIDLNNRTNSTQNHLLLSQECDSAHSLRLEMARAGTHQVSMETQESSSTLTVASRNSPA    211 - 280
SPLKELSGKLMKSIEQDAVNTFTKYISPDAAKPIPITEAMRNDIIARICGEDGQVDPNCFVLAQSIVFSA    281 - 350
MEQEHFSEFLRSHHFCKYQIEVLTSGTVYLADILFCESALFYFSEYMEKEDAVNILQFWLAADNFQSQLA    351 - 420
AKKGQYDGQEAQNDAMILYDKYFSLQATHPLGFDDVVRLEIESNICREGGPLPNCFTTPLRQAWTTMEKV    421 - 490
FLPGFLSSNLYYKYLNDLIHSVRGDEFLGGNVSLTAPGSVGPPDESHPGSSDSSASQSSVKKASIKILKN    491 - 560
FDEAIIVDAASLDPESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVRKSKGSMFSQAMKKWVQGNTDEA    561 - 630
QEELAWKIAKMIVSDIMQQAQYDQPLEKSTKL                                          631 - 662
//

Text Mined References (43)

PMID Year Title