Property Summary

NCBI Gene PubMed Count 38
PubMed Score 26.39
PubTator Score 35.19

Knowledge Summary


No data available


  Disease Sources (4)

Disease Target Count
Conduction disorder of the heart 1
Disease Target Count P-value
glioblastoma multiforme 347 1.26303895347755E-19
ovarian cancer 8492 2.84354126258826E-14
Pick disease 1893 8.55841653981337E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.59127305236894E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 3.17325348168056E-4
medulloblastoma, large-cell 6234 9.88369646303682E-4
oligodendroglioma 2849 0.00119220031566187
ependymoma 2514 0.00191102800990603
astrocytic glioma 2241 0.00531977969035895
osteosarcoma 7933 0.0066884083272331
lung cancer 4473 0.0102643784806952
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0332288064400572
ulcerative colitis 2087 0.0357903547866146
Disease Target Count
Cardiac Conduction Defect 1
Disease Target Count
Sudden Cardiac Death 8


  Differential Expression (13)


Accession O43572 B2R650 Q96AJ7 AKAP-10
Symbols PRKA10



3IM4   3TMH  

  Ortholog (15)

Gene RIF (28)

26110499 Significant association between the AKAP10 polymorphisms and reduced risk of Preterm birth in the Malays was observed.
25348485 Described is a structure of D-AKAP2 in complex with two interacting partners and the exact mechanism by which a segment that on its own is disordered presents an alpha-helix to PKA and a beta-strand to PDZK1.
25213315 Its signaling pathway is associated with the progression and prognosis of colorectal neoplasms.
23468363 Studied the clinicopathologic significance of A-kinase anchoring proteins 10 (AKAP 10) expression and the relationship with its polymorphism in colorectal cancer.
23095189 Questioned whether 1936A>G is associated with metabolic changes in newborns that are predictive of the metabolic phenotype in adults. Demonstrate an association between 1936G variant and total cholesterol level in cord blood of Polish newborns.
23092224 No significant differences were found in AKAP10 genotype or allele distribution between the age groups (newborn vs. nonagenerian) for either gender.
22817328 There is possible association between a 1936G AKAP10 variant and blood pressure in Polish newborns.
21701445 Results suggest G1936 polymorphism in A-kinase-anchoring protein is preventative factor against preterm birth, in contrast with previously asserted negative effects in adults.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

QEELAWKIAKMIVSDIMQQAQYDQPLEKSTKL                                          631 - 662

Text Mined References (42)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26110499 2015 Genetic association of AKAP10 gene polymorphism with reduced risk of preterm birth.
25348485 2015 D-AKAP2:PKA RII:PDZK1 ternary complex structure: insights from the nucleation of a polyvalent scaffold.
25213315 2015 PKA RI?/A-kinase anchoring proteins 10 signaling pathway and the prognosis of colorectal cancer.
23468363 2013 A-kinase anchoring proteins 10 expression in relation to 2073A/G polymorphism and tumor progression in patients with colorectal cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23095189 2013 Polymorphism 1936A > G in the AKAP10 gene (encoding A-kinase-anchoring protein 10) is associated with higher cholesterol cord blood concentration in Polish full-term newsborns.
23092224 2012 1936A?G (I646 V) polymorphism in the AKAP10 gene encoding A-kinase-anchoring protein 10 in very long-lived poles is similar to that in newborns.
22817328 2013 Association of 1936A > G in AKAP10 (A-kinase anchoring protein 10) and blood pressure in Polish full-term newborns.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.