Property Summary

NCBI Gene PubMed Count 17
PubMed Score 9.43
PubTator Score 8.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.176 0.003
osteosarcoma 2.422 0.000
medulloblastoma, large-cell -1.400 0.000
juvenile dermatomyositis 1.544 0.000
group 4 medulloblastoma -1.400 0.000
acute myeloid leukemia -1.100 0.039
ovarian cancer -2.300 0.000
Down syndrome 1.200 0.007

Synonym

Accession O43567 A6NC87 B3KR12 Q05D66 Q6IBJ9
Symbols RZF

Gene

Gene RIF (6)

PMID Text
24387786 Protease-activated point mutations are identified in RNF13 and RNF167.
23378536 RNF13 is a critical mediator for facilitating endoplasmic reticulum stress-induced apoptosis through the activation of the IRE1alpha-TRAF2-JNK signaling pathway.
20230530 analysis of nuclear targeting of Nuclear targeting of RNF13 endosomal E3 ubiquitin ligase
18794910 RNF13 is a novel E3 ubiquitin ligase involved in pancreatic carcinogenesis.
16166738 Mice lacking Mt1/2 have a rapid decrease in Rnf13 during acute lung injury
8610176 Cloning report of the chicken homolog

AA Sequence

MLLSIGMLMLSATQVYTILTVQLFAFLNLLPVEADILAYNFENASQTFDDLPARFGYRLPAEGLKGFLIN      1 - 70
SKPENACEPIVPPPVKDNSSGTFIVLIRRLDCNFDIKVLNAQRAGYKAAIVHNVDSDDLISMGSNDIEVL     71 - 140
KKIDIPSVFIGESSANSLKDEFTYEKGGHLILVPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDR    141 - 210
HRARRNRLRKDQLKKLPVHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCPV    211 - 280
CKQKVVPSQGDSDSDTDSSQEENEVTEHTPLLRPLASVSAQSFGALSESRSHQNMTESSDYEEDDNEDTD    281 - 350
SSDAENEINEHDVVVQLQPNGERDYNIANTV                                           351 - 381
//

Text Mined References (18)

PMID Year Title
25260751 2014 The MEKK1 PHD ubiquitinates TAB1 to activate MAPKs in response to cytokines.
24387786 2014 Tumour-associated mutations of PA-TM-RING ubiquitin ligases RNF167/RNF13 identify the PA domain as a determinant for endosomal localization.
23378536 2013 RNF13, a RING finger protein, mediates endoplasmic reticulum stress-induced apoptosis through the inositol-requiring enzyme (IRE1?)/c-Jun NH2-terminal kinase pathway.
20230530 2010 Nuclear targeting of an endosomal E3 ubiquitin ligase.
19690564 2009 A comprehensive framework of E2-RING E3 interactions of the human ubiquitin-proteasome system.
18794910 2009 RNF13: a novel RING-type ubiquitin ligase over-expressed in pancreatic cancer.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17897319 2007 Integral and associated lysosomal membrane proteins.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
More...