Property Summary

NCBI Gene PubMed Count 17
PubMed Score 9.69
PubTator Score 8.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
acute myeloid leukemia -1.100 3.9e-02
Down syndrome 1.200 6.7e-03
group 4 medulloblastoma -1.400 1.9e-04
juvenile dermatomyositis 1.333 6.2e-10
medulloblastoma, large-cell -1.400 1.2e-04
Multiple myeloma 1.176 3.2e-03
osteosarcoma 2.422 3.5e-07
ovarian cancer -1.800 2.5e-10

 GWAS Trait (1)

Protein-protein Interaction (11)

Gene RIF (6)

AA Sequence

MLLSIGMLMLSATQVYTILTVQLFAFLNLLPVEADILAYNFENASQTFDDLPARFGYRLPAEGLKGFLIN      1 - 70
SKPENACEPIVPPPVKDNSSGTFIVLIRRLDCNFDIKVLNAQRAGYKAAIVHNVDSDDLISMGSNDIEVL     71 - 140
KKIDIPSVFIGESSANSLKDEFTYEKGGHLILVPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDR    141 - 210
HRARRNRLRKDQLKKLPVHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCPV    211 - 280
CKQKVVPSQGDSDSDTDSSQEENEVTEHTPLLRPLASVSAQSFGALSESRSHQNMTESSDYEEDDNEDTD    281 - 350
SSDAENEINEHDVVVQLQPNGERDYNIANTV                                           351 - 381
//

Text Mined References (18)

PMID Year Title