Property Summary

NCBI Gene PubMed Count 23
PubMed Score 9.09
PubTator Score 10.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
glioblastoma 5,572

Expression

  Differential Expression (1)

Disease log2 FC p
glioblastoma -1.100 0.003

Synonym

Accession O43559 Q5T3D5 FGFR substrate 3
Symbols SNT2
FRS2B
SNT-2
FRS2beta
FRS2-beta

Gene

PDB

2KUP   2KUQ   2YS5   2YT2  

Gene RIF (7)

PMID Text
23279575 an FRS2beta-CIN85/CD2AP-Cbl axis for downregulation of ErbB2 may regulate ErbB2 protein levels in physiological and pathological settings
20228838 Mechanisms by which FRS2beta acts as a feedback inhibitor of EGFR family members and suggest a role for FRS2beta as a tumor suppressor.
19204726 Observational study of gene-disease association. (HuGE Navigator)
16702953 Novel mechanism of negative control of EGFR tyrosine kinase activity with SNT-2 by recruiting ERK2.
15485655 SNT-2 negatively regulates ERK2 signaling activated via EGF stimulation through direct binding to ERK2
15094036 FRS2beta can compensate for the loss of FRS2alpha for activation of MAP kinase when expressed in fibroblasts
11877385 FRS2 PTB domain conformation regulates interactions with divergent neurotrophic receptors

AA Sequence

MGSCCSCLNRDSVPDNHPTKFKVTNVDDEGVELGSGVMELTQSELVLHLHRREAVRWPYLCLRRYGYDSN      1 - 70
LFSFESGRRCQTGQGIFAFKCSRAEEIFNLLQDLMQCNSINVMEEPVIITRNSHPAELDLPRAPQPPNAL     71 - 140
GYTVSSFSNGCPGEGPRFSAPRRLSTSSLRHPSLGEESTHALIAPDEQSHTYVNTPASEDDHRRGRHCLQ    141 - 210
PLPEGQAPFLPQARGPDQRDPQVFLQPGQVKFVLGPTPARRHMVKCQGLCPSLHDPPHHNNNNEAPSECP    211 - 280
AQPKCTYENVTGGLWRGAGWRLSPEEPGWNGLAHRRAALLHYENLPPLPPVWESQAQQLGGEAGDDGDSR    281 - 350
DGLTPSSNGFPDGEEDETPLQKPTSTRAAIRSHGSFPVPLTRRRGSPRVFNFDFRRPGPEPPRQLNYIQV    351 - 420
ELKGWGGDRPKGPQNPSSPQAPMPTTHPARSSDSYAVIDLKKTVAMSNLQRALPRDDGTARKTRHNSTDL    421 - 490
PL                                                                        491 - 492
//

Text Mined References (23)

PMID Year Title
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25416956 2014 A proteome-scale map of the human interactome network.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
23279575 2013 Adaptor protein complex of FRS2? and CIN85/CD2AP provides a novel mechanism for ErbB2/HER2 protein downregulation.
20228838 2010 FRS2beta, a potential prognostic gene for non-small cell lung cancer, encodes a feedback inhibitor of EGF receptor family members by ERK binding.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
18985028 2008 Hepatitis C virus infection protein network.
16702953 2006 Unique role of SNT-2/FRS2beta/FRS3 docking/adaptor protein for negative regulation in EGF receptor tyrosine kinase signaling pathways.
16341674 2005 Transcriptome analysis of human gastric cancer.
15738000 2005 Direct interaction of Rnd1 with FRS2 beta regulates Rnd1-induced down-regulation of RhoA activity and is involved in fibroblast growth factor-induced neurite outgrowth in PC12 cells.
More...