Property Summary

NCBI Gene PubMed Count 23
PubMed Score 9.61
PubTator Score 10.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
glioblastoma 5792 2.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Hemorrhagic fever with renal syndrome 7 3.003 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
glioblastoma -1.100 2.5e-03

Synonym

Accession O43559 Q5T3D5 FGFR substrate 3
Symbols SNT2
FRS2B
SNT-2
FRS2beta
FRS2-beta

Gene

PDB

2KUP   2KUQ   2YS5   2YT2  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

AA Sequence

MGSCCSCLNRDSVPDNHPTKFKVTNVDDEGVELGSGVMELTQSELVLHLHRREAVRWPYLCLRRYGYDSN      1 - 70
LFSFESGRRCQTGQGIFAFKCSRAEEIFNLLQDLMQCNSINVMEEPVIITRNSHPAELDLPRAPQPPNAL     71 - 140
GYTVSSFSNGCPGEGPRFSAPRRLSTSSLRHPSLGEESTHALIAPDEQSHTYVNTPASEDDHRRGRHCLQ    141 - 210
PLPEGQAPFLPQARGPDQRDPQVFLQPGQVKFVLGPTPARRHMVKCQGLCPSLHDPPHHNNNNEAPSECP    211 - 280
AQPKCTYENVTGGLWRGAGWRLSPEEPGWNGLAHRRAALLHYENLPPLPPVWESQAQQLGGEAGDDGDSR    281 - 350
DGLTPSSNGFPDGEEDETPLQKPTSTRAAIRSHGSFPVPLTRRRGSPRVFNFDFRRPGPEPPRQLNYIQV    351 - 420
ELKGWGGDRPKGPQNPSSPQAPMPTTHPARSSDSYAVIDLKKTVAMSNLQRALPRDDGTARKTRHNSTDL    421 - 490
PL                                                                        491 - 492
//

Text Mined References (23)

PMID Year Title