Property Summary

NCBI Gene PubMed Count 363
Grant Count 624
R01 Count 379
Funding $52,237,216.29
PubMed Score 1340.64
PubTator Score 293.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Gene

PDB

4B4S   1F95   2K7W   2NL9   2V6Q   2VM6   2WH6   2YQ6   2YQ7   3D7V   3FDL   3IO8   3IO9   3KJ0   3KJ1   3KJ2   4A1U   4A1W   4D2M   4QVF   4UF3   4YJ4   4ZIE   4ZIF   4ZIH   5AGW   5AGX   5C3G  

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
588575 confirmatory 16 / 0 / 42 SAR analysis of selective Bcl-B inhibitors using fluorescence polarization assay
720677 confirmatory 4 / 0 / 3 SAR analysis of selective Bcl-B inhibitors using fluorescence polarization assay, set 2

Gene RIF (309)

PMID Text
26874859 Bcl-2 dependent NB cell lines are exquisitely sensitive to ABT-199 . Treatment with ABT-199 displaces Bim from Bcl-2 in NB to activate caspase 3, confirming the restoration of mitochondrial apoptosis
26795455 Jmjd3 regulates osteoblast apoptosis through targeting Bcl-2 expression and Bim phosphorylation.
26758252 miR-24 was found to be up-regulated while the expression of BCL2L11 was inhibited in tumor tissues of gastric cancer
26740175 Taken together, these results show that CHAF1A contributes to the proliferation of glioblastoma cells and may be developed as a de novo drug target and prognosis biomarker of glioblastoma.
26707131 The potent antitumor activity of RHL may be mediated through downregulation of Bcl-2 and cyclin D expression and upregulation of BAX and Bim expression.
26639561 mRNA expression of BIM and MTOR in 57 patients with EGFR-mutant non-small-cell lung cancer.
26572075 miR-181b/Bim pathway may be a novel target used to overcome the chemoresistance in breast cancer
26517680 the BIM deletion polymorphism enhanced the emergence of populations with complete imatinib resistance, mimicking the situation in patients.
26517093 miR-24 promotes tumor growth and angiogenesis by suppressing Bim expression in a model of pancreatic carcinoma
26497683 Fluorizoline bind to prohibitin, inducing mitochondrial apoptotic pathway through NOXA and BIM upregulation.
More...

AA Sequence

MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASP      1 - 70
GPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPA     71 - 140
DMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH                141 - 198
//

Text Mined References (371)

PMID Year Title
27013495 2016 The deubiquitinase Usp27x stabilizes the BH3-only protein Bim and enhances apoptosis.
26874859 2016 Select Bcl-2 antagonism restores chemotherapy sensitivity in high-risk neuroblastoma.
26859456 2016 Exploitation of the Apoptosis-Primed State of MYCN-Amplified Neuroblastoma to Develop a Potent and Specific Targeted Therapy Combination.
26795455 2016 Histone demethylase Jmjd3 regulates osteoblast apoptosis through targeting anti-apoptotic protein Bcl-2 and pro-apoptotic protein Bim.
26758252 2016 Onco-miR-24 regulates cell growth and apoptosis by targeting BCL2L11 in gastric cancer.
26740175 2016 Over-expression of CHAF1A promotes cell proliferation and apoptosis resistance in glioblastoma cells via AKT/FOXO3a/Bim pathway.
26707131 2016 Antitumor activity of rhein lysinate against human glioma U87 cells in vitro and in vivo.
26639561 2015 BIM and mTOR expression levels predict outcome to erlotinib in EGFR-mutant non-small-cell lung cancer.
26572075 2016 MiR-181b promotes chemoresistance in breast cancer by regulating Bim expression.
26517680 2016 The BIM deletion polymorphism: A paradigm of a permissive interaction between germline and acquired TKI resistance factors in chronic myeloid leukemia.
More...