Property Summary

NCBI Gene PubMed Count 393
PubMed Score 1465.77
PubTator Score 293.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
adult high grade glioma 1.100 2.4e-04
aldosterone-producing adenoma -1.074 2.0e-02
astrocytic glioma 1.100 1.8e-02
Astrocytoma, Pilocytic 1.400 2.3e-04
atypical teratoid / rhabdoid tumor 1.100 5.1e-06
ependymoma 1.400 5.4e-03
gastric cancer -1.200 1.1e-03
glioblastoma 1.400 4.8e-06
group 3 medulloblastoma 1.100 1.8e-03
hepatocellular carcinoma -1.300 5.2e-06
invasive ductal carcinoma 1.100 4.3e-03
lung cancer 2.000 2.6e-03
malignant mesothelioma 1.300 4.0e-04
medulloblastoma, large-cell 1.700 3.2e-04
mucosa-associated lymphoid tissue lympho... 1.089 6.6e-03
non-small cell lung cancer 1.207 4.3e-15
oligodendroglioma 1.100 9.5e-03
osteosarcoma 1.976 1.8e-08
ovarian cancer 1.100 5.1e-07
pancreatic cancer -1.200 3.3e-03
pancreatic carcinoma -1.200 3.3e-03
primary pancreatic ductal adenocarcinoma 1.036 5.1e-03
primitive neuroectodermal tumor 1.900 3.5e-05
tuberculosis -1.100 1.3e-03
ulcerative colitis -1.100 4.9e-04

Protein-protein Interaction (10)

Gene RIF (336)

AA Sequence

MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASP      1 - 70
GPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPA     71 - 140
DMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH                141 - 198
//

Text Mined References (401)

PMID Year Title