Property Summary

NCBI Gene PubMed Count 47
Grant Count 66
R01 Count 31
Funding $7,503,095.99
PubMed Score 100.91
PubTator Score 61.20

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O43516 B8ZZM1 D3DPE4 Q15220 Q53TA9 Q6MZU9 Q9BU37 Q9UNP1
Symbols WIP
WAS2
PRPL-2
WASPIP

Gene

PDB

2A41  

Gene RIF (18)

PMID Text
25413351 conclude that tyrosine phosphorylation of WIP is a crucial regulator of WASP stability and function as an actin-nucleation-promoting factor
24962707 Data indicate the WASp-interacting protein (WIP)-Wiskott-Aldrich syndrome protein (WASp) interaction in the regulation of actin-dependent processes.
22837718 WIP was shown to interact with various binding partners, including the signaling proteins Nck, CrkL and cortactin.
22231303 These findings indicate that WIP deficiency should be suspected in patients with features of WAS in whom WAS sequence and mRNA levels are normal.
21810783 These findings reveal WIP as a previously unreported regulator of neuronal maturation and synaptic activity
19817875 The results suggest that some of the mutations in the WH1 domain cause the Wiskott-Aldrich syndrome syndrome in humans by perturbing the WASP-WIP complex formation.
19399471 Groups of colorectal cancer, breast cancer, and glioma patients with low expression of the WIPF1 co-expression module generally had a favorable prognosis.
19155218 formin-binding protein 17 (FBP17) recruits WASP, WASP-interacting protein (WIP), and dynamin-2 to the plasma membrane and that this recruitment is necessary for the formation of podosomes and phagocytic cups.
18258743 WIP is involved in lytic granule transport and is essential for regulation of Natural killer cell cytotoxic function
17949983 In this review, in addition to its WASP-independent functions, the role of WIP is to regulate the activity and stability of WASP and shuttle WASP to areas of actin assembly.
More...

AA Sequence

MPVPPPPAPPPPPTFALANTEKPTLNKTEQAGRNALLSDISKGKKLKKTVTNDRSAPILDKPKGAGAGGG      1 - 70
GGGFGGGGGFGGGGGGGGGGSFGGGGPPGLGGLFQAGMPKLRSTANRDNDSGGSRPPLLPPGGRSTSAKP     71 - 140
FSPPSGPGRFPVPSPGHRSGPPEPQRNRMPPPRPDVGSKPDSIPPPVPSTPRPIQSSPHNRGSPPVPGGP    141 - 210
RQPSPGPTPPPFPGNRGTALGGGSIRQSPLSSSSPFSNRPPLPPTPSRALDDKPPPPPPPVGNRPSIHRE    211 - 280
AVPPPPPQNNKPPVPSTPRPSASSQAPPPPPPPSRPGPPPLPPSSSGNDETPRLPQRNLSLSSSTPPLPS    281 - 350
PGRSGPLPPPPSERPPPPVRDPPGRSGPLPPPPPVSRNGSTSRALPATPQLPSRSGVDSPRSGPRPPLPP    351 - 420
DRPSAGAPPPPPPSTSIRNGFQDSPCEDEWESRFYFHPISDLPPPEPYVQTTKSYPSKLARNESRSGSNR    421 - 490
RERGAPPLPPIPR                                                             491 - 503
//

Text Mined References (59)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25413351 2015 Tyrosine phosphorylation of WIP releases bound WASP and impairs podosome assembly in macrophages.
24962707 2014 Triple-color FRET analysis reveals conformational changes in the WIP-WASp actin-regulating complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22837718 2012 WIP remodeling actin behind the scenes: how WIP reshapes immune and other functions.
22231303 2012 A novel primary human immunodeficiency due to deficiency in the WASP-interacting protein WIP.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
More...