Property Summary

NCBI Gene PubMed Count 54
PubMed Score 107.43
PubTator Score 61.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Wiskott-Aldrich syndrome 30 5.642 2.8
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Chronic purulent otitis media 8 3.21 1.6
Disease Target Count
Wiskott-Aldrich Syndrome 2 1

Expression

  Differential Expression (21)

Disease log2 FC p
Astrocytoma, Pilocytic 2.100 2.0e-08
cutaneous lupus erythematosus 2.000 5.6e-03
cystic fibrosis -1.200 1.1e-04
Duchenne muscular dystrophy 1.171 8.5e-09
gastric carcinoma 1.600 3.6e-02
glioblastoma 1.300 1.9e-04
hepatocellular carcinoma -1.300 7.0e-05
interstitial cystitis 1.700 4.2e-03
intraductal papillary-mucinous neoplasm ... -2.100 4.1e-02
juvenile dermatomyositis 1.144 3.7e-09
lung carcinoma -1.700 1.8e-24
malignant mesothelioma -3.000 1.5e-08
medulloblastoma, large-cell -1.600 2.8e-02
osteosarcoma -1.254 1.3e-02
ovarian cancer -2.100 5.2e-05
pediatric high grade glioma 1.600 3.5e-05
primary Sjogren syndrome 1.800 3.1e-04
sarcoidosis 1.600 1.4e-02
tuberculosis and treatment for 3 months -1.100 7.2e-04
ulcerative colitis 1.700 1.1e-03
Waldenstrons macroglobulinemia 1.644 7.8e-03

Protein-protein Interaction (2)

Gene RIF (23)

AA Sequence

MPVPPPPAPPPPPTFALANTEKPTLNKTEQAGRNALLSDISKGKKLKKTVTNDRSAPILDKPKGAGAGGG      1 - 70
GGGFGGGGGFGGGGGGGGGGSFGGGGPPGLGGLFQAGMPKLRSTANRDNDSGGSRPPLLPPGGRSTSAKP     71 - 140
FSPPSGPGRFPVPSPGHRSGPPEPQRNRMPPPRPDVGSKPDSIPPPVPSTPRPIQSSPHNRGSPPVPGGP    141 - 210
RQPSPGPTPPPFPGNRGTALGGGSIRQSPLSSSSPFSNRPPLPPTPSRALDDKPPPPPPPVGNRPSIHRE    211 - 280
AVPPPPPQNNKPPVPSTPRPSASSQAPPPPPPPSRPGPPPLPPSSSGNDETPRLPQRNLSLSSSTPPLPS    281 - 350
PGRSGPLPPPPSERPPPPVRDPPGRSGPLPPPPPVSRNGSTSRALPATPQLPSRSGVDSPRSGPRPPLPP    351 - 420
DRPSAGAPPPPPPSTSIRNGFQDSPCEDEWESRFYFHPISDLPPPEPYVQTTKSYPSKLARNESRSGSNR    421 - 490
RERGAPPLPPIPR                                                             491 - 503
//

Text Mined References (66)

PMID Year Title