Property Summary

NCBI Gene PubMed Count 37
PubMed Score 26.48
PubTator Score 31.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (29)

Disease log2 FC p
active Crohn's disease 1.212 2.6e-02
Atopic dermatitis -1.100 1.5e-02
atypical teratoid / rhabdoid tumor -1.500 3.0e-03
autosomal dominant Emery-Dreifuss muscul... 1.014 1.8e-02
Breast cancer -1.500 3.4e-08
breast carcinoma -1.400 1.6e-04
Chronic Lymphocytic Leukemia -1.563 1.3e-07
Down syndrome 1.400 2.9e-03
Duchenne muscular dystrophy 1.193 2.4e-07
ductal carcinoma in situ -1.300 6.2e-03
esophageal adenocarcinoma 1.200 4.5e-02
fibroadenoma -1.200 3.9e-02
gastric carcinoma 1.300 2.4e-02
Gaucher disease type 1 -1.200 4.6e-02
group 4 medulloblastoma -1.800 4.7e-04
invasive ductal carcinoma -1.800 2.3e-03
juvenile dermatomyositis 1.071 3.7e-09
lung adenocarcinoma -1.200 2.8e-15
lung carcinoma -2.000 9.4e-21
medulloblastoma, large-cell -2.000 6.6e-04
non-small cell lung carcinoma -1.300 7.5e-27
osteosarcoma 2.509 1.6e-04
ovarian cancer -2.000 9.6e-05
pancreatic cancer 1.100 4.6e-03
pituitary cancer 1.200 9.5e-04
primary pancreatic ductal adenocarcinoma 1.172 2.0e-02
primitive neuroectodermal tumor -1.100 2.5e-02
psoriasis -2.000 1.1e-04
Waldenstrons macroglobulinemia -1.480 1.1e-05

Gene RIF (8)

AA Sequence

MTTEVGSVSEVKKDSSQLGTDATKEKPKEVAENQQNQSSDPEEEKGSQPPPAAESQSSLRRQKREKETSE      1 - 70
SRGISRFIPPWLKKQKSYTLVVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIK     71 - 140
VEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKETQEDKLEGGAAKRETKEVQTNELKAEKASQK    141 - 210
VTKKTKTVQCKVTLLDGTEYSCDLEKHAKGQVLFDKVCEHLNLLEKDYFGLLFQESPEQKNWLDPAKEIK    211 - 280
RQLRNLPWLFTFNVKFYPPDPSQLTEDITRYFLCLQLRQDIASGRLPCSFVTHALLGSYTLQAELGDYDP    281 - 350
EEHGSIDLSEFQFAPTQTKELEEKVAELHKTHRGLSPAQADSQFLENAKRLSMYGVDLHHAKDSEGVDIK    351 - 420
LGVCANGLLIYKDRLRINRFAWPKILKISYKRSNFYIKVRPAELEQFESTIGFKLPNHRAAKRLWKVCVE    421 - 490
HHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQASTLIDRPAPHFERTSSKRVSRSLDGAPIGVMD    491 - 560
QSLMKDFPGAAGEISAYGPGLVSIAVVQDGDGRREVRSPTKAPHLQLIEGKKNSLRVEGDNIYVRHSNLM    561 - 630
LEELDKAQEDILKHQASISELKRNFMESTPEPRPNEWEKRRITPLSLQTQGSSHETLNIVEEKKRAEVGK    631 - 700
DERVITEEMNGKEISPGSGPGEIRKVEPVTQKDSTSLSSESSSSSSESEEEDVGEYRPHHRVTEGTIREE    701 - 770
QEYEEEVEEEPRPAAKVVEREEAVPEASPVTQAGASVITVETVIQENVGAQKIPGEKSVHEGALKQDMGE    771 - 840
EAEEEPQKVNGEVSHVDIDVLPQIICCSEPPVVKTEMVTISDASQRTEISTKEVPIVQTETKTITYESPQ    841 - 910
IDGGAGGDSGTLLTAQTITSESVSTTTTTHITKTVKGGISETRIEKRIVITGDGDIDHDQALAQAIREAR    911 - 980
EQHPDMSVTRVVVHKETELAEEGED                                                 981 - 1005
//

Text Mined References (54)

PMID Year Title