Property Summary

NCBI Gene PubMed Count 35
PubMed Score 25.26
PubTator Score 31.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung carcinoma 413 7.46895930866578E-27
lung carcinoma 2844 9.41454709221058E-21
lung adenocarcinoma 2714 2.82670936035875E-15
juvenile dermatomyositis 1189 3.69152254255961E-9
Breast cancer 3099 3.3842649443811E-8
chronic lymphocytic leukemia 244 1.2646789241625E-7
Duchenne muscular dystrophy 602 2.3725756290713E-7
Waldenstrons macroglobulinemia 765 1.10777997267851E-5
ovarian cancer 8492 9.58204826419853E-5
invasive ductal carcinoma 2950 1.15781725780791E-4
psoriasis 6685 1.21362439417553E-4
breast carcinoma 1614 1.55236624477948E-4
osteosarcoma 7933 1.62747867401959E-4
medulloblastoma, large-cell 6234 6.57359396964241E-4
pituitary cancer 1972 9.49840212518005E-4
medulloblastoma 1524 0.00158438335482658
Down syndrome 548 0.00292132813293989
atypical teratoid / rhabdoid tumor 4369 0.00298249690174361
pancreatic cancer 2300 0.00458300143473351
ductal carcinoma in situ 1745 0.00621519437150618
active Crohn's disease 918 0.00812332297202668
Atopic dermatitis 944 0.0154092095384738
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.017615632809607
primary pancreatic ductal adenocarcinoma 1271 0.0195175316657332
gastric carcinoma 832 0.0240088492411854
primitive neuroectodermal tumor 3031 0.0248732000314463
fibroadenoma 557 0.0385023375417245
esophageal adenocarcinoma 737 0.0449964794242379
Gaucher disease type 1 171 0.0456039806137558
Disease Target Count Z-score Confidence
Malignant ependymoma 4 3.777 1.9

Expression

  Differential Expression (29)

Synonym

Accession O43491 B4DHI8 E9PPD9 Q5T4F0 Q68DV2
Symbols 4.1G
4.1-G

Gene

  Ortholog (11)

Gene RIF (8)

PMID Text
25631074 Cellular biotinylated erythrocyte membrane protein band 4.1-like 2 (EPB41L2) protein is incorporated into HIV-1 Gag virus-like particles
23354586 Ca(2+)/CaM binding to GHP, and more specifically to pepG, has profound effects on other functional domains of 4.1G
23201780 4.1G protein depresses PTH-related protein receptor-mediated Gs signaling pathway by suppression of adenylyl cyclase-mediated cAMP production.
22003208 A phosphoserine-dependent tethering role for protein 4.1G in lipid rafts provides insight into the unique phosphoserine-based regulation of FcgammaRI receptor signaling.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20189245 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18023480 An alternatively spliced 4.1G product is shown to be associated with increased Fc gamma RI binding in yeast two-hybrid assays, and to be selectively enriched in most immune cells at the transcript level.
15138281 PTA-1(CD226 antigen) is localized to membrane rafts and binds the carboxyl-terminal domain of isoforms of the actin-binding protein 4.1G and also can bind human discs large providing the structural basis for a regulated molecular adhesive complex

AA Sequence

MTTEVGSVSEVKKDSSQLGTDATKEKPKEVAENQQNQSSDPEEEKGSQPPPAAESQSSLRRQKREKETSE      1 - 70
SRGISRFIPPWLKKQKSYTLVVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIK     71 - 140
VEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKETQEDKLEGGAAKRETKEVQTNELKAEKASQK    141 - 210
VTKKTKTVQCKVTLLDGTEYSCDLEKHAKGQVLFDKVCEHLNLLEKDYFGLLFQESPEQKNWLDPAKEIK    211 - 280
RQLRNLPWLFTFNVKFYPPDPSQLTEDITRYFLCLQLRQDIASGRLPCSFVTHALLGSYTLQAELGDYDP    281 - 350
EEHGSIDLSEFQFAPTQTKELEEKVAELHKTHRGLSPAQADSQFLENAKRLSMYGVDLHHAKDSEGVDIK    351 - 420
LGVCANGLLIYKDRLRINRFAWPKILKISYKRSNFYIKVRPAELEQFESTIGFKLPNHRAAKRLWKVCVE    421 - 490
HHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQASTLIDRPAPHFERTSSKRVSRSLDGAPIGVMD    491 - 560
QSLMKDFPGAAGEISAYGPGLVSIAVVQDGDGRREVRSPTKAPHLQLIEGKKNSLRVEGDNIYVRHSNLM    561 - 630
LEELDKAQEDILKHQASISELKRNFMESTPEPRPNEWEKRRITPLSLQTQGSSHETLNIVEEKKRAEVGK    631 - 700
DERVITEEMNGKEISPGSGPGEIRKVEPVTQKDSTSLSSESSSSSSESEEEDVGEYRPHHRVTEGTIREE    701 - 770
QEYEEEVEEEPRPAAKVVEREEAVPEASPVTQAGASVITVETVIQENVGAQKIPGEKSVHEGALKQDMGE    771 - 840
EAEEEPQKVNGEVSHVDIDVLPQIICCSEPPVVKTEMVTISDASQRTEISTKEVPIVQTETKTITYESPQ    841 - 910
IDGGAGGDSGTLLTAQTITSESVSTTTTTHITKTVKGGISETRIEKRIVITGDGDIDHDQALAQAIREAR    911 - 980
EQHPDMSVTRVVVHKETELAEEGED                                                 981 - 1005
//

Text Mined References (51)

PMID Year Title
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25192705 2014 No evidence of gene-calcium interactions from genome-wide analysis of colorectal cancer risk.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23354586 2013 Novel mechanism of regulation of protein 4.1G binding properties through Ca2+/calmodulin-mediated structural changes.
23201780 2013 Suppression of adenylyl cyclase-mediated cAMP production by plasma membrane associated cytoskeletal protein 4.1G.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22903471 2013 Genome-wide association identifies genetic variants associated with lentiform nucleus volume in N?=?1345 young and elderly subjects.
22361696 2012 Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy.
More...