Property Summary

NCBI Gene PubMed Count 418
Grant Count 327
R01 Count 144
Funding $33,032,155.11
PubMed Score 1922.48
PubTator Score 1503.13

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O43490 Q6SV49 Q6SV50 Q6SV51 Q6SV52 Q6SV53 Q96EN6
Symbols RP41
AC133
CD133
MCDR2
STGD4
CORD12
PROML1
MSTP061

Gene

PANTHER Protein Class (1)

Gene RIF (383)

PMID Text
26898076 CD133 expression was mainly seen in the apical/endoluminal cell surface of ovarian serous carcinoma cells and was found in 61% of the carcinoma samples and 41% of the peritoneal metastases.
26758620 CD133(+) Hepatocellular carcinoma cancer stem cell resisted IFN-g-induced autophagy, which might also be a mechanism through which cancer stem cell resist immune eradication.
26722393 meta-analysis results suggest that CD133 is an efficient prognostic factor in pancreatic ductal adenocarcinoma
26702251 A novel and unique intronic mutation of PROM1, underlying autosomal recessive cone-rod dystrophy in a consanguineous Israeli family, was found.
26690524 Overexpression of CD133 mRNA and BMI1 protein was found in 47.6 and 76.2% patients respectively.
26625750 Detecting the expression of CD133 and ALDH1 in invasive ductal breast carcinomas may be of help in more accurately predicting the aggressive properties and determining the optimal treatment.
26608413 CD44 and CD133 might participate in early-stage endometrial cancer carcinogenesis
26539911 Results suggest that p53-mediated transcriptional regulation of CD133 is a key underlying mechanism for controlling the growth and tumor-initiating capacity of CSCs.
26530530 Results show that CD133 expression was increased in the pancreatic ductal adenocarcinoma tissues and inversely correlated with LXN expression.
26515729 High CD133 expression is associated with cancer.
More...

AA Sequence

MALVLGSLLLLGLCGNSFSGGQPSSTDAPKAWNYELPATNYETQDSHKAGPIGILFELVHIFLYVVQPRD      1 - 70
FPEDTLRKFLQKAYESKIDYDKPETVILGLKIVYYEAGIILCCVLGLLFIILMPLVGYFFCMCRCCNKCG     71 - 140
GEMHQRQKENGPFLRKCFAISLLVICIIISIGIFYGFVANHQVRTRIKRSRKLADSNFKDLRTLLNETPE    141 - 210
QIKYILAQYNTTKDKAFTDLNSINSVLGGGILDRLRPNIIPVLDEIKSMATAIKETKEALENMNSTLKSL    211 - 280
HQQSTQLSSSLTSVKTSLRSSLNDPLCLVHPSSETCNSIRLSLSQLNSNPELRQLPPVDAELDNVNNVLR    281 - 350
TDLDGLVQQGYQSLNDIPDRVQRQTTTVVAGIKRVLNSIGSDIDNVTQRLPIQDILSAFSVYVNNTESYI    351 - 420
HRNLPTLEEYDSYWWLGGLVICSLLTLIVIFYYLGLLCGVCGYDRHATPTTRGCVSNTGGVFLMVGVGLS    421 - 490
FLFCWILMIIVVLTFVFGANVEKLICEPYTSKELFRVLDTPYLLNEDWEYYLSGKLFNKSKMKLTFEQVY    491 - 560
SDCKKNRGTYGTLHLQNSFNISEHLNINEHTGSISSELESLKVNLNIFLLGAAGRKNLQDFAACGIDRMN    561 - 630
YDSYLAQTGKSPAGVNLLSFAYDLEAKANSLPPGNLRNSLKRDAQTIKTIHQQRVLPIEQSLSTLYQSVK    631 - 700
ILQRTGNGLLERVTRILASLDFAQNFITNNTSSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKP    701 - 770
VATALDTAVDVFLCSYIIDPLNLFWFGIGKATVFLLPALIFAVKLAKYYRRMDSEDVYDDVETIPMKNME    771 - 840
NGNNGYHKDHVYGIHNPVMTSPSQH                                                 841 - 865
//

Text Mined References (423)

PMID Year Title
26898076 2015 Expression of CD133 and CD117 in 64 Serous Ovarian Cancer Cases.
26758620 2016 CD133+ liver cancer stem cells resist interferon-gamma-induced autophagy.
26722393 2015 Prognostic value of cancer stem cell marker CD133 expression in pancreatic ductal adenocarcinoma (PDAC): a systematic review and meta-analysis.
26702251 2015 An intronic deletion in the PROM1 gene leads to autosomal recessive cone-rod dystrophy.
26690524 2015 CD133 and BMI1 expressions and its prognostic role in primary glioblastoma.
26625750 2015 Clinicopathological Significance of CD133 and ALDH1 Cancer Stem Cell Marker Expression in Invasive Ductal Breast Carcinoma.
26608413 2016 Immunohistochemical expression of cancer stem cell related markers CD44 and CD133 in endometrial cancer.
26539911 2015 Transcriptional repression of cancer stem cell marker CD133 by tumor suppressor p53.
26530530 2016 Latexin exhibits tumor-suppressor potential in pancreatic ductal adenocarcinoma.
26515729 2015 Polarized cell migration induces cancer type-specific CD133/integrin/Src/Akt/GSK3?/?-catenin signaling required for maintenance of cancer stem cell properties.
More...