Property Summary

NCBI Gene PubMed Count 24
PubMed Score 61.42
PubTator Score 11.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
lung cancer 4,466
ovarian cancer 8,484

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.100 0.001
ovarian cancer 2.000 0.000

Gene RIF (5)

PMID Text
25746840 High TPD52L2 expression is associated with gastric cancer.
25629696 Authors found that TPD52L2 is extensively expressed in multiple human breast cancer cell lines.
24052230 hABCF3 positively regulates cell proliferation, at least partially through the interaction with a tumor protein D52 protein family member: TPD52L2.
23529586 TPD54 may serve as a novel biomarker for oral squamous cell carcinoma.
16620967 The results indicate that tumor protein D52-like 2 genes are not ubiquitously expressed in leukemic bone marrow in children, and that RNA sample parameters may influence measures of gene expression more than commonly appreciated.

AA Sequence

MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAK      1 - 70
ERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKT     71 - 140
SAALSTVGSAISRKLGDMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLSDPAPF        141 - 206
//

Text Mined References (37)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25746840 2015 Tumor protein D52-like 2 accelerates gastric cancer cell proliferation in vitro.
25629696 2015 Tumor protein D52-like 2 contributes to proliferation of breast cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24052230 2013 hABCF3, a TPD52L2 interacting partner, enhances the proliferation of human liver cancer cell lines in vitro.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23529586 2013 Tumor protein D54 is a negative regulator of extracellular matrix-dependent migration and attachment in oral squamous cell carcinoma-derived cell lines.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...