Property Summary

NCBI Gene PubMed Count 23
PubMed Score 68.95
PubTator Score 11.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 4.9e-07
lung cancer 4740 6.2e-04

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.100 6.2e-04
ovarian cancer 2.000 4.9e-07

Gene RIF (4)

AA Sequence

MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAK      1 - 70
ERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKT     71 - 140
SAALSTVGSAISRKLGDMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLSDPAPF        141 - 206
//

Text Mined References (36)

PMID Year Title