Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.17
PubTator Score 1.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ependymoma 4679 1.7e-12
group 4 medulloblastoma 1855 3.2e-03
colon cancer 1478 1.1e-02
Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 0.5
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Plexiform neurofibroma 2 3.288 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
colon cancer -1.100 1.1e-02
ependymoma -1.100 1.7e-12
group 4 medulloblastoma -1.100 3.2e-03

AA Sequence

MGSLTFRDVAIEFSLEEWQCLDTAQQNLYRNVMLENYRNLVFLGIAAFKPDLIIFLEEGKESWNMKRHEM      1 - 70
VEESPVICSHFAQDLWPEQGIEDSFQKVILRRYEKCGHENLHLKIGYTNVDECKVHKEGYNKLNQSLTTT     71 - 140
QSKVFQRGKYANVFHKCSNSNRHKIRHTGKKHLQCKEYVRSFCMLSHLSQHKRIYTRENSYKCEEGGKAF    141 - 210
NWSSTLTYYKSAHTGEKPYRCKECGKAFSKFSILTKHKVIHTGEKSYKCEECGKAFNQSAILTKHKIIHT    211 - 280
GEKPNKCEECGKAFSKVSTLTTHKAIHAGEKPYKCKECGKAFSKVSTLITHKAIHAGEKPYKCKECGKAF    281 - 350
SKFSILTKHKVIHTGEKPYKCEECGKAYKWPSTLSYHKKIHTGEKPYKCEECGKGFSMFSILTKHEVIHT    351 - 420
GEKPYKCEECGKAFNWSSNLMEHKKIHTGETPYKCEECGKGFSMFSILTKHKVIHNGEKPYKCEECDKAT    421 - 490
HAGEKPYKCEECGKAFNWSSNLMEHKRIHTGEKPYKCEECGKSFSTFSILTKHKVIHTGEKPYKCEECGK    491 - 560
AYKWSSTLSYHKKIHTVEKPYKCEECGKAFNQSAILIKHKRIHTGEKPYKCEECGKTFSKVSTLTTHKAI    561 - 630
HAGEKPYKCKECGKTFIKVSTLTTHKAIHAGEKPYKCKECGKAFSKFSILTKHKVIHTGEKPYKCEECGK    631 - 700
AFNWSSNLMEHKRIHTGEKPYKCEECGKSFSTFSVLTKHKVIHTGEKPYKCEECGKAYKWSSTLSYHKKI    701 - 770
HTVEKPYKCEECGKAFNRSAILIKHKRIHTDEKPYKCEECGKTFSKVSTLTTHKAIHAGEKPYKCKECGK    771 - 840
AFSKFSILTKHKVIHTGEKPYKCEECGKAYKWPSTLSYHKKIHTGEKPYKCEECGKGFSMFSILTKHEVI    841 - 910
HTGEKPYKCEECGKAFSWLSVFSKHKKTHAGEKFYKCEACGKAYKSSSTLSYHKKIHTEEKPYKYEECGK    911 - 980
GFSTFSILTKHKVIHTGEKPYKCEECGKAFNWSSNLMEHKKIHTGETPYKCEECDKAFSWPSSLTEHKAT    981 - 1050
HAGEKPYKCEECGKAFSWPSRLTEHKATHAGEEPYKCEECGKAFNWSSNLMEHKRIHTGEKPYKCEECGK   1051 - 1120
SFSTFSILTKHKVIHTGEKPYKCEECGKAYKWSSTLSYHKKIHTVEKPYKCEECGKGFVMFSILAKHKVI   1121 - 1190
HTGEKLYKCEECGKAYKWPSTLRYHKKIHTGEKPYKCEECGKAFSTFSILTKHKVIHTGEKPYKCEECGK   1191 - 1260
AFSWLSVFSKHKKIHTGEKL                                                     1261 - 1280
//

Text Mined References (6)

PMID Year Title