Property Summary

NCBI Gene PubMed Count 7
PubMed Score 8.39
PubTator Score 3.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 1.23079567872395E-17
posterior fossa group A ependymoma 1511 2.21395694768719E-12
pituitary cancer 1972 2.99372247176056E-8
ovarian cancer 8492 4.71677872012679E-7
atypical teratoid / rhabdoid tumor 4369 1.31679072399084E-4
pediatric high grade glioma 2712 1.85400544371482E-4
lung cancer 4473 4.58046236393013E-4
glioblastoma 5572 8.40317475837394E-4
psoriasis 6685 0.00133741279428837
sonic hedgehog group medulloblastoma 1482 0.0022027485101372
invasive ductal carcinoma 2950 0.00264039569704081
osteosarcoma 7933 0.00686962819650991
colon cancer 1475 0.0282286954596923
Disease Target Count Z-score Confidence
Schizophrenia 503 3.218 1.6
Autistic Disorder 320 3.093 1.5

Synonym

Accession O43300 A0AVL3 A8K4U9 B7ZLN8 Q7L770
Symbols

Gene

PANTHER Protein Class (1)

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (2)

PMID Text
21708131 CTNNA1 and CTNNA2 contain alternative 5' exons linked to bidirectional promoters that are shared with the antisense oriented LRRTM2 and LRRTM1 genes, respectively.
19240791 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGLHFKWPLGAPMLAAIYAMSMVLKMLPALGMACPPKCRCEKLLFYCDSQGFHSVPNATDKGSLGLSLRH      1 - 70
NHITELERDQFASFSQLTWLHLDHNQISTVKEDAFQGLYKLKELILSSNKIFYLPNTTFTQLINLQNLDL     71 - 140
SFNQLSSLHPELFYGLRKLQTLHLRSNSLRTIPVRLFWDCRSLEFLDLSTNRLRSLARNGFAGLIKLREL    141 - 210
HLEHNQLTKINFAHFLRLSSLHTLFLQWNKISNLTCGMEWTWGTLEKLDLTGNEIKAIDLTVFETMPNLK    211 - 280
ILLMDNNKLNSLDSKILNSLRSLTTVGLSGNLWECSARICALASWLGSFQGRWEHSILCHSPDHTQGEDI    281 - 350
LDAVHGFQLCWNLSTTVTVMATTYRDPTTEYTKRISSSSYHVGDKEIPTTAGIAVTTEEHFPEPDNAIFT    351 - 420
QRVITGTMALLFSFFFIIFIVFISRKCCPPTLRRIRQCSMVQNHRQLRSQTRLHMSNMSDQGPYNEYEPT    421 - 490
HEGPFIIINGYGQCKCQQLPYKECEV                                                491 - 516
//

Text Mined References (8)

PMID Year Title
21708131 2011 Bidirectional transcription from human LRRTM2/CTNNA1 and LRRTM1/CTNNA2 gene loci leads to expression of N-terminally truncated CTNNA1 and CTNNA2 isoforms.
19240791 2009 Integrated genomic analysis implicates haploinsufficiency of multiple chromosome 5q31.2 genes in de novo myelodysplastic syndromes pathogenesis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12676565 2003 A novel gene family encoding leucine-rich repeat transmembrane proteins differentially expressed in the nervous system.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9455477 1997 Prediction of the coding sequences of unidentified human genes. VIII. 78 new cDNA clones from brain which code for large proteins in vitro.