Property Summary

NCBI Gene PubMed Count 24
PubMed Score 58.51
PubTator Score 21.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.700 6.6e-05
Astrocytoma, Pilocytic -1.300 2.9e-06
cystic fibrosis -1.200 7.9e-05
glioblastoma -1.600 5.6e-07
interstitial cystitis -1.400 1.0e-02
lung carcinoma 1.600 7.8e-15
medulloblastoma -1.200 1.6e-03
medulloblastoma, large-cell -1.200 1.9e-02
osteosarcoma 1.033 1.3e-03
Pick disease 1.100 1.1e-02
pituitary cancer 1.500 1.5e-05
primitive neuroectodermal tumor -1.200 1.9e-02
progressive supranuclear palsy 1.600 8.1e-03
subependymal giant cell astrocytoma -2.454 1.8e-02
urothelial carcinoma -1.400 5.6e-03

 GWAS Trait (1)

Protein-protein Interaction (8)

Gene RIF (12)

AA Sequence

MSSQTKFKKDKEIIAEYEAQIKEIRTQLVEQFKCLEQQSESRLQLLQDLQEFFRRKAEIELEYSRSLEKL      1 - 70
AERFSSKIRSSREHQFKKDQYLLSPVNCWYLVLHQTRRESRDHATLNDIFMNNVIVRLSQISEDVIRLFK     71 - 140
KSKEIGLQMHEELLKVTNELYTVMKTYHMYHAESISAESKLKEAEKQEEKQFNKSGDLSMNLLRHEDRPQ    141 - 210
RRSSVKKIEKMKEKRQAKYSENKLKCTKARNDYLLNLAATNAAISKYYIHDVSDLIDCCDLGFHASLART    211 - 280
FRTYLSAEYNLETSRHEGLDVIENAVDNLDSRSDKHTVMDMCNQVFCPPLKFEFQPHMGDEVCQVSAQQP    281 - 350
VQTELLMRYHQLQSRLATLKIENEEVRKTLDATMQTLQDMLTVEDFDVSDAFQHSRSTESVKSAASETYM    351 - 420
SKINIAKRRANQQETEMFYFTKFKEYVNGSNLITKLQAKHDLLKQTLGEGERAECGTTRPPCLPPKPQKM    421 - 490
RRPRPLSVYSHKLFNGSMEAFIKDSGQAIPLVVESCIRYINLYGLQQQGIFRVPGSQVEVNDIKNSFERG    491 - 560
EDPLVDDQNERDINSVAGVLKLYFRGLENPLFPKERFQDLISTIKLENPAERVHQIQQILVTLPRVVIVV    561 - 630
MRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMHIPDGQDPVSCQAHINEVIKTIIIHHEAIFPSPREL    631 - 700
EGPVYEKCMAGGEEYCDSPHSEPGAIDEVDHDNGTEPHTSDEEVEQIEAIAKFDYMGRSPRELSFKKGAS    701 - 770
LLLYHRASEDWWEGRHNGVDGLIPHQYIVVQDMDDAFSDSLSQKADSEASSGPLLDDKASSKNDLQSPTE    771 - 840
HISDYGFGGVMGRVRLRSDGAAIPRRRSGGDTHSPPRGLGPSIDTPPRAAACPSSPHKIPLTRGRIESPE    841 - 910
KRRMATFGSAGSINYPDKKALSEGHSMRSTCGSTRHSSLGDHKSLEAEALAEDIEKTMSTALHELRELER    911 - 980
QNTVKQAPDVVLDTLEPLKNPPGPVSSEPASPLHTIVIRDPDAAMRRSSSSSTEMMTTFKPALSARLAGA    981 - 1050
QLRPPPMRPVRPVVQHRSSSSSSSGVGSPAVTPTEKMFPNSSADKSGTM                        1051 - 1099
//

Text Mined References (27)

PMID Year Title