Property Summary

NCBI Gene PubMed Count 38
Grant Count 9
R01 Count 6
Funding $924,110
PubMed Score 66.05
PubTator Score 37.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

 GO Function (1)

Gene RIF (14)

PMID Text
26362536 HIV-1 Gag interacts with SART1 as demonstrated by proximity dependent biotinylation proteomics
25915846 Data indicate that mutant VHL can protect HIF1alpha from SART1-dependent degradation in normoxic conditions, but this protection is lost in hypoxic settings, favoring hypoxia-dependent ccRCC proliferation.
25481564 SART1 exerts its anti-Hepatitis C virus action through direct transcriptional regulation for some Interferon stimulating genes and alternative splicing for others.
23125841 HIV-1 Gag interacts with SART1 as demonstrated by proximity dependent biotinylation proteomics
23125841 HIV-1 Gag interacts with SART1 as demonstrated by proximity dependent biotinylation proteomics
23125841 HIV-1 Gag interacts with SART1 as demonstrated by proximity dependent biotinylation proteomics
23125841 HIV-1 Gag interacts with SART1 as demonstrated by proximity dependent biotinylation proteomics
22944692 HIV-1 Gag interacts with SART1 as demonstrated by proximity dependent biotinylation proteomics
22027693 This study identifies SART1 as a previously unidentified regulator of c-FLIP and drug-induced activation of caspase-8.
20056645 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MGSSKKHRGEKEAAGTTAAAGTGGATEQPPRHREHKKHKHRSGGSGGSGGERRKRSRERGGERGSGRRGA      1 - 70
EAEARSSTHGRERSQAEPSERRVKREKRDDGYEAAASSKTSSGDASSLSIEETNKLRAKLGLKPLEVNAI     71 - 140
KKEAGTKEEPVTADVINPMALRQREELREKLAAAKEKRLLNQKLGKIKTLGEDDPWLDDTAAWIERSRQL    141 - 210
QKEKDLAEKRAKLLEEMDQEFGVSTLVEEEFGQRRQDLYSARDLQGLTVEHAIDSFREGETMILTLKDKG    211 - 280
VLQEEEDVLVNVNLVDKERAEKNVELRKKKPDYLPYAEDESVDDLAQQKPRSILSKYDEELEGERPHSFR    281 - 350
LEQGGTADGLRERELEEIRAKLRLQAQSLSTVGPRLASEYLTPEEMVTFKKTKRRVKKIRKKEKEVVVRA    351 - 420
DDLLPLGDQTQDGDFGSRLRGRGRRRVSEVEEEKEPVPQPLPSDDTRVENMDISDEEEGGAPPPGSPQVL    421 - 490
EEDEAELELQKQLEKGRRLRQLQQLQQLRDSGEKVVEIVKKLESRQRGWEEDEDPERKGAIVFNATSEFC    491 - 560
RTLGEIPTYGLAGNREEQEELMDFERDEERSANGGSESDGEENIGWSTVNLDEEKQQQDFSASSTTILDE    561 - 630
EPIVNRGLAAALLLCQNKGLLETTVQKVARVKAPNKSLPSAVYCIEDKMAIDDKYSRREEYRGFTQDFKE    631 - 700
KDGYKPDVKIEYVDETGRKLTPKEAFRQLSHRFHGKGSGKMKTERRMKKLDEEALLKKMSSSDTPLGTVA    701 - 770
LLQEKQKAQKTPYIVLSGSGKSMNANTITK                                            771 - 800
//

Text Mined References (54)

PMID Year Title
25915846 2016 Mutant versions of von Hippel-Lindau (VHL) can protect HIF1? from SART1-mediated degradation in clear-cell renal cell carcinoma.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25481564 2015 The spliceosome factor SART1 exerts its anti-HCV action through mRNA splicing.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25092792 2014 UBL5 is essential for pre-mRNA splicing and sister chromatid cohesion in human cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
More...