Property Summary

NCBI Gene PubMed Count 38
PubMed Score 66.05
PubTator Score 37.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
malignant mesothelioma 3163 1.63788480084788E-6
ovarian cancer 8492 1.29220217435889E-5
osteosarcoma 7933 3.64547348210477E-5
diabetes mellitus 1663 0.00345770328439991
Multiple myeloma 1328 0.00598505158921475
Subcutaneous panniculitis-like T-cell lymphoma 16 0.00947731329549269
glioblastoma multiforme 347 0.0101913013864929
astrocytoma 1493 0.0136011897606067
acute myeloid leukemia 785 0.0143173923537573
non diabetic and post-ischemic heart failure 200 0.0294140928511957
non primary Sjogren syndrome sicca 840 0.0434099868110848

Expression

  Differential Expression (11)

Synonym

Accession O43290 A6NDN1 Q53GB5
Symbols Ara1
HOMS1
Snu66
SART1259
SNRNP110

Gene

PANTHER Protein Class (1)

PDB

4PYU  

  Ortholog (12)

 GO Function (1)

Gene RIF (11)

PMID Text
26362536 HIV-1 Gag interacts with SART1 as demonstrated by proximity dependent biotinylation proteomics
25915846 Data indicate that mutant VHL can protect HIF1alpha from SART1-dependent degradation in normoxic conditions, but this protection is lost in hypoxic settings, favoring hypoxia-dependent ccRCC proliferation.
25481564 SART1 exerts its anti-Hepatitis C virus action through direct transcriptional regulation for some Interferon stimulating genes and alternative splicing for others.
23125841 HIV-1 Gag interacts with SART1 as demonstrated by proximity dependent biotinylation proteomics
22944692 HIV-1 Gag interacts with SART1 as demonstrated by proximity dependent biotinylation proteomics
22027693 This study identifies SART1 as a previously unidentified regulator of c-FLIP and drug-induced activation of caspase-8.
20056645 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18838541 hypoxia-associated factor (HAF), also known as SART1, a protein expressed in proliferating cells, binds and ubiquitinates HIF-1alpha in vitro, and both binding and E3 ligase activity are mediated by HAF amino acids 654 to 800
18374504 Observational study of gene-disease association. (HuGE Navigator)
12189166 hypothesize that polymorphic variation within the SART-1 gene may account for individuals developing atopy
More...

AA Sequence

MGSSKKHRGEKEAAGTTAAAGTGGATEQPPRHREHKKHKHRSGGSGGSGGERRKRSRERGGERGSGRRGA      1 - 70
EAEARSSTHGRERSQAEPSERRVKREKRDDGYEAAASSKTSSGDASSLSIEETNKLRAKLGLKPLEVNAI     71 - 140
KKEAGTKEEPVTADVINPMALRQREELREKLAAAKEKRLLNQKLGKIKTLGEDDPWLDDTAAWIERSRQL    141 - 210
QKEKDLAEKRAKLLEEMDQEFGVSTLVEEEFGQRRQDLYSARDLQGLTVEHAIDSFREGETMILTLKDKG    211 - 280
VLQEEEDVLVNVNLVDKERAEKNVELRKKKPDYLPYAEDESVDDLAQQKPRSILSKYDEELEGERPHSFR    281 - 350
LEQGGTADGLRERELEEIRAKLRLQAQSLSTVGPRLASEYLTPEEMVTFKKTKRRVKKIRKKEKEVVVRA    351 - 420
DDLLPLGDQTQDGDFGSRLRGRGRRRVSEVEEEKEPVPQPLPSDDTRVENMDISDEEEGGAPPPGSPQVL    421 - 490
EEDEAELELQKQLEKGRRLRQLQQLQQLRDSGEKVVEIVKKLESRQRGWEEDEDPERKGAIVFNATSEFC    491 - 560
RTLGEIPTYGLAGNREEQEELMDFERDEERSANGGSESDGEENIGWSTVNLDEEKQQQDFSASSTTILDE    561 - 630
EPIVNRGLAAALLLCQNKGLLETTVQKVARVKAPNKSLPSAVYCIEDKMAIDDKYSRREEYRGFTQDFKE    631 - 700
KDGYKPDVKIEYVDETGRKLTPKEAFRQLSHRFHGKGSGKMKTERRMKKLDEEALLKKMSSSDTPLGTVA    701 - 770
LLQEKQKAQKTPYIVLSGSGKSMNANTITK                                            771 - 800
//

Text Mined References (54)

PMID Year Title
25915846 2016 Mutant versions of von Hippel-Lindau (VHL) can protect HIF1? from SART1-mediated degradation in clear-cell renal cell carcinoma.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25481564 2015 The spliceosome factor SART1 exerts its anti-HCV action through mRNA splicing.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25092792 2014 UBL5 is essential for pre-mRNA splicing and sister chromatid cohesion in human cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
More...