Property Summary

NCBI Gene PubMed Count 39
PubMed Score 70.50
PubTator Score 37.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
acute myeloid leukemia 1.200 8.6e-03
astrocytoma 1.400 1.4e-02
diabetes mellitus 1.100 1.5e-02
glioblastoma multiforme 1.300 1.0e-02
malignant mesothelioma 1.400 1.6e-06
Multiple myeloma 1.000 6.0e-03
non diabetic and post-ischemic heart fai... -1.300 2.9e-02
non primary Sjogren syndrome sicca 1.100 4.3e-02
osteosarcoma -1.614 3.6e-05
ovarian cancer 1.700 1.3e-05
Subcutaneous panniculitis-like T-cell ly... 1.100 3.9e-03

 GO Function (1)

Gene RIF (12)

AA Sequence

MGSSKKHRGEKEAAGTTAAAGTGGATEQPPRHREHKKHKHRSGGSGGSGGERRKRSRERGGERGSGRRGA      1 - 70
EAEARSSTHGRERSQAEPSERRVKREKRDDGYEAAASSKTSSGDASSLSIEETNKLRAKLGLKPLEVNAI     71 - 140
KKEAGTKEEPVTADVINPMALRQREELREKLAAAKEKRLLNQKLGKIKTLGEDDPWLDDTAAWIERSRQL    141 - 210
QKEKDLAEKRAKLLEEMDQEFGVSTLVEEEFGQRRQDLYSARDLQGLTVEHAIDSFREGETMILTLKDKG    211 - 280
VLQEEEDVLVNVNLVDKERAEKNVELRKKKPDYLPYAEDESVDDLAQQKPRSILSKYDEELEGERPHSFR    281 - 350
LEQGGTADGLRERELEEIRAKLRLQAQSLSTVGPRLASEYLTPEEMVTFKKTKRRVKKIRKKEKEVVVRA    351 - 420
DDLLPLGDQTQDGDFGSRLRGRGRRRVSEVEEEKEPVPQPLPSDDTRVENMDISDEEEGGAPPPGSPQVL    421 - 490
EEDEAELELQKQLEKGRRLRQLQQLQQLRDSGEKVVEIVKKLESRQRGWEEDEDPERKGAIVFNATSEFC    491 - 560
RTLGEIPTYGLAGNREEQEELMDFERDEERSANGGSESDGEENIGWSTVNLDEEKQQQDFSASSTTILDE    561 - 630
EPIVNRGLAAALLLCQNKGLLETTVQKVARVKAPNKSLPSAVYCIEDKMAIDDKYSRREEYRGFTQDFKE    631 - 700
KDGYKPDVKIEYVDETGRKLTPKEAFRQLSHRFHGKGSGKMKTERRMKKLDEEALLKKMSSSDTPLGTVA    701 - 770
LLQEKQKAQKTPYIVLSGSGKSMNANTITK                                            771 - 800
//

Text Mined References (56)

PMID Year Title