Property Summary

NCBI Gene PubMed Count 19
PubMed Score 540.09
PubTator Score 29.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute quadriplegic myopathy 1.007 8.2e-04
Breast cancer 3.100 3.5e-02
glioblastoma 1.100 2.8e-02
intraductal papillary-mucinous carcinoma... 1.500 2.2e-03
intraductal papillary-mucinous neoplasm ... 2.000 2.7e-03
osteosarcoma -1.501 5.9e-05
ovarian cancer 1.100 7.7e-03
pancreatic cancer 1.100 4.0e-05
pediatric high grade glioma 1.200 3.9e-04
primary pancreatic ductal adenocarcinoma 1.243 2.6e-02
psoriasis -2.700 4.6e-04
tuberculosis -1.400 7.6e-06

Gene RIF (8)

AA Sequence

MRARRGLLRLPRRSLLAALFFFSLSSSLLYFVYVAPGIVNTYLFMMQAQGILIRDNVRTIGAQVYEQVLR      1 - 70
SAYAKRNSSVNDSDYPLDLNHSETFLQTTTFLPEDFTYFANHTCPERLPSMKGPIDINMSEIGMDYIHEL     71 - 140
FSKDPTIKLGGHWKPSDCMPRWKVAILIPFRNRHEHLPVLFRHLLPMLQRQRLQFAFYVVEQVGTQPFNR    141 - 210
AMLFNVGFQEAMKDLDWDCLIFHDVDHIPESDRNYYGCGQMPRHFATKLDKYMYLLPYTEFFGGVSGLTV    211 - 280
EQFRKINGFPNAFWGWGGEDDDLWNRVQNAGYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKER    281 - 350
QGLDGLNNLNYFANITYDALYKNITVNLTPELAQVNEY                                    351 - 388
//

Text Mined References (19)

PMID Year Title