Property Summary

NCBI Gene PubMed Count 19
Grant Count 13
Funding $3,226,497.9
PubMed Score 509.35
PubTator Score 29.28

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
23744354 B4GALT1 and B4GALT5, two members of B4GALT gene family, are involved in the development of multidrug resistance of human leukemia cells.
22687727 The expression of the beta-1,4-GalT V gene has been shown to be regulated by transcription factors Sp1 and Ets-1 in cancer cells.(review)
20417617 These data reveal a critical role of beta1,4GalT V in the self-renewal and tumorigenicity of glioma-initiating cells.
17690104 sulfated keratan sulfate is produced by beta3GNT7, beta4GalT4, CGn6ST, and KSG6ST
17656364 Ets-1 enhances expression of the beta-1,4-GalT V gene through activation of the Sp1 gene in cancer cells
16461357 results suggest that GalT V functioned as a novel glioma growth activator and might represent a novel target in glioma therapy
12385586 Over-expression of beta-1,4-galactosyltransferase V increases the growth of astrocytoma cell line

AA Sequence

MRARRGLLRLPRRSLLAALFFFSLSSSLLYFVYVAPGIVNTYLFMMQAQGILIRDNVRTIGAQVYEQVLR      1 - 70
SAYAKRNSSVNDSDYPLDLNHSETFLQTTTFLPEDFTYFANHTCPERLPSMKGPIDINMSEIGMDYIHEL     71 - 140
FSKDPTIKLGGHWKPSDCMPRWKVAILIPFRNRHEHLPVLFRHLLPMLQRQRLQFAFYVVEQVGTQPFNR    141 - 210
AMLFNVGFQEAMKDLDWDCLIFHDVDHIPESDRNYYGCGQMPRHFATKLDKYMYLLPYTEFFGGVSGLTV    211 - 280
EQFRKINGFPNAFWGWGGEDDDLWNRVQNAGYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKER    281 - 350
QGLDGLNNLNYFANITYDALYKNITVNLTPELAQVNEY                                    351 - 388
//

Text Mined References (19)

PMID Year Title
23744354 2013 B4GALT family mediates the multidrug resistance of human leukemia cells by regulating the hedgehog pathway and the expression of p-glycoprotein and multidrug resistance-associated protein 1.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
22687727 2012 [Regulation of human ?-1,4-galactosyltransferase V gene expression in cancer cells].
20417617 2010 Beta1,4-galactosyltransferase V regulates self-renewal of glioma-initiating cell.
17690104 2007 Enzymes responsible for synthesis of corneal keratan sulfate glycosaminoglycans.
17656364 2007 Sequential action of Ets-1 and Sp1 in the activation of the human beta-1,4-galactosyltransferase V gene involved in abnormal glycosylation characteristic of cancer cells.
16461357 2006 Beta1,4-galactosyltransferase V functions as a positive growth regulator in glioma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15263012 2004 Transcriptional regulation of the human beta-1,4-galactosyltransferase V gene in cancer cells: essential role of transcription factor Sp1.
More...