Property Summary

NCBI Gene PubMed Count 76
Grant Count 115
R01 Count 39
Funding $34,391,328.89
PubMed Score 715.13
PubTator Score 115.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 3.400 0.000
uncontrolled asthma 1.400 0.004
psoriasis -1.600 0.000
cutaneous lupus erythematosus -1.700 0.002
glioblastoma -1.300 0.000
sonic hedgehog group medulloblastoma -2.200 0.000
medulloblastoma, large-cell -1.600 0.000
pediatric high grade glioma -1.600 0.000
lung carcinoma -1.400 0.000

Synonym

Accession O43272 A6NF53 O14680 Q0P507 Q147W8 Q504W1 Q59FI8 Q6NV86 Q9UF13
Symbols POX
PIG6
HSPOX2
PRODH1
PRODH2
TP53I6

Gene

PANTHER Protein Class (2)

 GWAS Trait (1)

Gene RIF (61)

PMID Text
26436492 The findings support a major role for the PRODH 757TT, 1766GG, and 1852AA genotypes alone and in combination for schizophrenia susceptibility.
26330555 HIV-1 Env gp120 upregulates the mitochondrial redox enzyme PRODH (POX)
26330555 HIV-1 Env gp120 upregulates the mitochondrial redox enzyme PRODH (POX)
26088140 GR and KLF15 physically interact via low affinity GR binding sites within glucocorticoid response elements (GREs) for PRODH and AASS that contribute to combinatorial regulation with KLF15.
26068888 Thirty-five percent of the subjects were hyperprolinemic, allele carriers of PRODH rs450046 had a lower full-scale intelligence compared to T allele carriers
25325218 results suggest that PRODH and COMT may interact to contribute to the ASD phenotype in individuals with VCFS
24853458 Functional COMT, but not PRODH, variant affects IQ and executive functions in 22q11.2DS subjects during neurodevelopment with a maximal effect at adulthood
24498354 Data indicate that a functional proline dehydrogenase (PRODH) variant associated with schizophrenia that may have a neurochemical impact, altering brain function, but is not responsible for the cortical reductions found in the disorder.
24218577 Human-specific endogenous retroviral insert serves as an enhancer for the schizophrenia-linked gene PRODH.
23910792 The current study demonstrates that sensory gating impairments that are typical of schizophrenia are found in 22q11.2DS subjects. Our results further suggest that COMT and PRODH genetic variations contribute to sensory gating.
More...

AA Sequence

MALRRALPALRPCIPRFVQLSTAPASREQPAAGPAAVPGGGSATAVRPPVPAVDFGNAQEAYRSRRTWEL      1 - 70
ARSLLVLRLCAWPALLARHEQLLYVSRKLLGQRLFNKLMKMTFYGHFVAGEDQESIQPLLRHYRAFGVSA     71 - 140
ILDYGVEEDLSPEEAEHKEMESCTSAAERDGSGTNKRDKQYQAHRAFGDRRNGVISARTYFYANEAKCDS    141 - 210
HMETFLRCIEASGRVSDDGFIAIKLTALGRPQFLLQFSEVLAKWRCFFHQMAVEQGQAGLAAMDTKLEVA    211 - 280
VLQESVAKLGIASRAEIEDWFTAETLGVSGTMDLLDWSSLIDSRTKLSKHLVVPNAQTGQLEPLLSRFTE    281 - 350
EEELQMTRMLQRMDVLAKKATEMGVRLMVDAEQTYFQPAISRLTLEMQRKFNVEKPLIFNTYQCYLKDAY    351 - 420
DNVTLDVELARREGWCFGAKLVRGAYLAQERARAAEIGYEDPINPTYEATNAMYHRCLDYVLEELKHNAK    421 - 490
AKVMVASHNEDTVRFALRRMEELGLHPADHQVYFGQLLGMCDQISFPLGQAGYPVYKYVPYGPVMEVLPY    491 - 560
LSRRALENSSLMKGTHRERQLLWLELLRRLRTGNLFHRPA                                  561 - 600
//

Text Mined References (78)

PMID Year Title
26436492 2015 Relationship between polymorphisms in the proline dehydrogenase gene and schizophrenia risk.
26088140 2015 Response Element Composition Governs Correlations between Binding Site Affinity and Transcription in Glucocorticoid Receptor Feed-forward Loops.
26068888 2015 PRODH rs450046 and proline x COMT Val¹?? Met interaction effects on intelligence and startle in adults with 22q11 deletion syndrome.
25325218 2014 Association between autism spectrum disorder in individuals with velocardiofacial (22q11.2 deletion) syndrome and PRODH and COMT genotypes.
24853458 2014 Association of COMT and PRODH gene variants with intelligence quotient (IQ) and executive functions in 22q11.2DS subjects.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24498354 2014 PRODH polymorphisms, cortical volumes and thickness in schizophrenia.
24218577 2013 Human-specific endogenous retroviral insert serves as an enhancer for the schizophrenia-linked gene PRODH.
23910792 2013 Schizophrenia-like neurophysiological abnormalities in 22q11.2 deletion syndrome and their association to COMT and PRODH genotypes.
More...