Property Summary

NCBI Gene PubMed Count 65
Grant Count 55
R01 Count 26
Funding $5,905,853.34
PubMed Score 62.57
PubTator Score 46.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.600 0.000
non-small cell lung cancer 1.294 0.000
lung cancer 1.300 0.019
subependymal giant cell astrocytoma -1.119 0.028

 GWAS Trait (1)

Gene RIF (45)

PMID Text
26859780 Our results suggest that SIAH2 regulates multi processes in T-cell acute lymphoblastic leukemia
26654769 SIAH2 is associated with a tumor promoting role in breast cancer.
26580787 The expression of SIAH2 is increased in human lung cancer.
26512788 Overexpression of Siah2 Is Associated With Epithelial Ovarian Carcinoma
26392558 Data show that ubiquitin E3 ligase Siah2 depletion delays circadian degradation of nuclear hormone receptor RevErbalpha (Nr1d1) and lengthens period length.
26160177 A catalysis-independent role for AKR1C3 on AR activity via Siah2 has been identified.
25997740 The down-regulation of SIAH2 conferred sensitivity to anti-cancer drugs. The results of the study indicated that the miR-335/SIAH2/HDAC3 axis regulates the response to anti-cancer drugs.
25528765 Data indicate that ubiquitin ligase Siah as a regulator of to Mesenchymal Transition (EMT) by controlling the abundance of the key transcription factor Zeb1, while Siah itself is subject to regulation by EMT-inducing factors.
25438054 the E3 ubiquitin ligase SIAH2 stimulates YAP by destabilizing LATS2, a critical component of the Hippo pathway, in response to hypoxia.
25202994 molecular basis of Siah1 and Siah2 E3 ubiquitin ligase substrate specificity
More...

AA Sequence

MSRPSSTGPSANKPCSKQPPPQPQHTPSPAAPPAAATISAAGPGSSAVPAAAAVISGPGGGGGAGPVSPQ      1 - 70
HHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKY     71 - 140
ATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDI    141 - 210
NLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATP    211 - 280
RSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCP                              281 - 324
//

Text Mined References (68)

PMID Year Title
26859780 2016 The expression and function of E3 ligase SIAH2 in acute T lymphoblastic leukemia.
26654769 2015 SIAH ubiquitin ligases regulate breast cancer cell migration and invasion independent of the oxygen status.
26580787 2015 The Expression of the Ubiquitin Ligase SIAH2 (Seven In Absentia Homolog 2) Is Increased in Human Lung Cancer.
26512788 2016 Overexpression of Siah2 Is Associated With Poor Prognosis in Patients With Epithelial Ovarian Carcinoma.
26392558 2015 Ubiquitin ligase Siah2 regulates RevErb? degradation and the mammalian circadian clock.
26160177 2015 The Steroidogenic Enzyme AKR1C3 Regulates Stability of the Ubiquitin Ligase Siah2 in Prostate Cancer Cells.
25997740 2015 miR-335 Targets SIAH2 and Confers Sensitivity to Anti-Cancer Drugs by Increasing the Expression of HDAC3.
25528765 2015 The ubiquitin ligase Siah is a novel regulator of Zeb1 in breast cancer.
25438054 2015 Hypoxia regulates Hippo signalling through the SIAH2 ubiquitin E3 ligase.
25202994 2014 Investigating the molecular basis of Siah1 and Siah2 E3 ubiquitin ligase substrate specificity.
More...