Property Summary

NCBI Gene PubMed Count 24
Grant Count 3
Funding $509,672.25
PubMed Score 15.01
PubTator Score 26.56

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O43150 D6W4Y8
Symbols PAP
PAG3
AMAP2
DDEF2
SHAG1
CENTB3
Pap-alpha

Gene

Gene RIF (2)

PMID Text
20944657 Observational study of gene-disease association. (HuGE Navigator)
15231847 regulates multiple cytokine and growth factor-activated signaling pathways by acting as a recruitment factor for adapter proteins

AA Sequence

MPDQISVSEFVAETHEDYKAPTASSFTTRTAQCRNTVAAIEEALDVDRMVLYKMKKSVKAINSSGLAHVE      1 - 70
NEEQYTQALEKFGGNCVCRDDPDLGSAFLKFSVFTKELTALFKNLIQNMNNIISFPLDSLLKGDLKGVKG     71 - 140
DLKKPFDKAWKDYETKITKIEKEKKEHAKLHGMIRTEISGAEIAEEMEKERRFFQLQMCEYLLKVNEIKI    141 - 210
KKGVDLLQNLIKYFHAQCNFFQDGLKAVESLKPSIETLSTDLHTIKQAQDEERRQLIQLRDILKSALQVE    211 - 280
QKEDSQIRQSTAYSLHQPQGNKEHGTERNGSLYKKSDGIRKVWQKRKCSVKNGFLTISHGTANRPPAKLN    281 - 350
LLTCQVKTNPEEKKCFDLISHDRTYHFQAEDEQECQIWMSVLQNSKEEALNNAFKGDDNTGENNIVQELT    351 - 420
KEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLDVLGTSELLLAK    421 - 490
NIGNAGFNEIMECCLPAEDSVKPNPGSDMNARKDYITAKYIERRYARKKHADNAAKLHSLCEAVKTRDIF    491 - 560
GLLQAYADGVDLTEKIPLANGHEPDETALHLAVRSVDRTSLHIVDFLVQNSGNLDKQTGKGSTALHYCCL    561 - 630
TDNAECLKLLLRGKASIEIANESGETPLDIAKRLKHEHCEELLTQALSGRFNSHVHVEYEWRLLHEDLDE    631 - 700
SDDDMDEKLQPSPNRREDRPISFYQLGSNQLQSNAVSLARDAANLAKEKQRAFMPSILQNETYGALLSGS    701 - 770
PPPAQPAAPSTTSAPPLPPRNVGKVQTASSANTLWKTNSVSVDGGSRQRSSSDPPAVHPPLPPLRVTSTN    771 - 840
PLTPTPPPPVAKTPSVMEALSQPSKPAPPGISQIRPPPLPPQPPSRLPQKKPAPGADKSTPLTNKGQPRG    841 - 910
PVDLSATEALGPLSNAMVLQPPAPMPRKSQATKLKPKRVKALYNCVADNPDELTFSEGDVIIVDGEEDQE    911 - 980
WWIGHIDGDPGRKGAFPVSFVHFIAD                                                981 - 1006
//

Publication (29)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23999061 2014 The ASAP2 gene is a primary target of 1,25-dihydroxyvitamin D3 in human monocytes and macrophages.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21706016 2011 Selected reaction monitoring mass spectrometry reveals the dynamics of signaling through the GRB2 adaptor.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20944657 2011 Replication of top markers of a genome-wide association study in multiple sclerosis in Spain.
20936779 2010 A human MAP kinase interactome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19010793 2009 Genome-wide association analysis of susceptibility and clinical phenotype in multiple sclerosis.
18786926 2008 Identification of a link between the SAMP repeats of adenomatous polyposis coli tumor suppressor and the Src homology 3 domain of DDEF.
More...