Property Summary

NCBI Gene PubMed Count 24
PubMed Score 15.10
PubTator Score 26.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
autosomal dominant Emery-Dreifuss muscul... 1.157 6.7e-03
Barrett's esophagus 1.100 2.5e-02
Duchenne muscular dystrophy 1.060 4.2e-07
esophageal adenocarcinoma 1.200 1.8e-02
fibroadenoma -1.200 1.9e-02
intraductal papillary-mucinous adenoma (... 2.000 8.4e-04
intraductal papillary-mucinous carcinoma... 1.900 2.6e-03
intraductal papillary-mucinous neoplasm ... 1.900 1.4e-02
juvenile dermatomyositis 1.195 6.1e-11
lung cancer -1.500 1.1e-04
osteosarcoma -1.021 3.8e-02
ovarian cancer 1.200 1.8e-02
pancreatic cancer 1.300 4.8e-04
pancreatic carcinoma 1.300 4.8e-04
pituitary cancer -1.400 7.2e-04
psoriasis -1.100 3.8e-07
spina bifida -1.661 2.6e-02
tuberculosis 1.900 4.5e-06

Gene RIF (2)

AA Sequence

MPDQISVSEFVAETHEDYKAPTASSFTTRTAQCRNTVAAIEEALDVDRMVLYKMKKSVKAINSSGLAHVE      1 - 70
NEEQYTQALEKFGGNCVCRDDPDLGSAFLKFSVFTKELTALFKNLIQNMNNIISFPLDSLLKGDLKGVKG     71 - 140
DLKKPFDKAWKDYETKITKIEKEKKEHAKLHGMIRTEISGAEIAEEMEKERRFFQLQMCEYLLKVNEIKI    141 - 210
KKGVDLLQNLIKYFHAQCNFFQDGLKAVESLKPSIETLSTDLHTIKQAQDEERRQLIQLRDILKSALQVE    211 - 280
QKEDSQIRQSTAYSLHQPQGNKEHGTERNGSLYKKSDGIRKVWQKRKCSVKNGFLTISHGTANRPPAKLN    281 - 350
LLTCQVKTNPEEKKCFDLISHDRTYHFQAEDEQECQIWMSVLQNSKEEALNNAFKGDDNTGENNIVQELT    351 - 420
KEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLDVLGTSELLLAK    421 - 490
NIGNAGFNEIMECCLPAEDSVKPNPGSDMNARKDYITAKYIERRYARKKHADNAAKLHSLCEAVKTRDIF    491 - 560
GLLQAYADGVDLTEKIPLANGHEPDETALHLAVRSVDRTSLHIVDFLVQNSGNLDKQTGKGSTALHYCCL    561 - 630
TDNAECLKLLLRGKASIEIANESGETPLDIAKRLKHEHCEELLTQALSGRFNSHVHVEYEWRLLHEDLDE    631 - 700
SDDDMDEKLQPSPNRREDRPISFYQLGSNQLQSNAVSLARDAANLAKEKQRAFMPSILQNETYGALLSGS    701 - 770
PPPAQPAAPSTTSAPPLPPRNVGKVQTASSANTLWKTNSVSVDGGSRQRSSSDPPAVHPPLPPLRVTSTN    771 - 840
PLTPTPPPPVAKTPSVMEALSQPSKPAPPGISQIRPPPLPPQPPSRLPQKKPAPGADKSTPLTNKGQPRG    841 - 910
PVDLSATEALGPLSNAMVLQPPAPMPRKSQATKLKPKRVKALYNCVADNPDELTFSEGDVIIVDGEEDQE    911 - 980
WWIGHIDGDPGRKGAFPVSFVHFIAD                                                981 - 1006
//

Text Mined References (29)

PMID Year Title