Property Summary

NCBI Gene PubMed Count 26
PubMed Score 70.57
PubTator Score 20.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
malignant mesothelioma 3232 4.7e-06
group 4 medulloblastoma 1855 5.7e-05
ovarian cancer 8520 7.1e-05
medulloblastoma, large-cell 6241 7.9e-04
spina bifida 1074 4.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Dubowitz syndrome 13 4.069 2.0
Amnestic disorder 35 3.298 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
group 4 medulloblastoma 1.200 5.7e-05
malignant mesothelioma 1.100 4.7e-06
medulloblastoma, large-cell 1.200 7.9e-04
ovarian cancer 1.100 7.1e-05
spina bifida -1.632 4.0e-02

 MGI Phenotype (1)

Protein-protein Interaction (5)

Gene RIF (10)

AA Sequence

MANSAKAEEYEKMSLEQAKASVNSETESSFNINENTTASGTGLSEKTSVCRQVDIARKRKEFEDDLVKES      1 - 70
SSCGKDTPSKKRKLDPEIVPEEKDCGDAEGNSKKRKRETEDVPKDKSSTGDGTQNKRKIALEDVPEKQKN     71 - 140
LEEGHSSTVAAHYNELQEVGLEKRSQSRIFYLRNFNNWMKSVLIGEFLEKVRQKKKRDITVLDLGCGKGG    141 - 210
DLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDSEYIFSAEFITADSSKELLIDKFRDPQMCFDI    211 - 280
CSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGD    281 - 350
YPLFGCKYDFNLEGVVDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQALEP    351 - 420
YPANESSKLVSEKVDDYEHAAKYMKNSQVRLPLGTLSKSEWEATSIYLVFAFEKQQ                  421 - 476
//

Text Mined References (27)

PMID Year Title