Property Summary

NCBI Gene PubMed Count 22
Grant Count 81
R01 Count 25
Funding $9,125,178.54
PubMed Score 78.96
PubTator Score 20.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
medulloblastoma, large-cell 1.200 0.001
group 4 medulloblastoma 1.200 0.000
spina bifida -1.632 0.040
ovarian cancer 1.100 0.000

Synonym

Accession O43148 B0YJ90 D3DUJ5 O94996 Q9UIJ9
Symbols MET
Met
CMT1
cm1p
hMet
CMT1c
hCMT1
RG7MT1

Gene

PDB

3BGV   3EPP   5E8J   5E9J   5E9W  

 MGI Term (1)

Protein-protein Interaction (9)

Gene RIF (7)

PMID Text
26942677 CDK1-Cyclin B1 activates RNMT, coordinating mRNA cap methylation with G1 phase transcription.
24763612 High RNMT expression is associated with liver cancer.
24200467 Data suggest the C-terminal nuclear localization domain (QYP) is critical for RAM (RNMT-activating mini protein) to enter the cell nucleus where RAM activates RNMT resulting in mRNA cap methylation. TNPO1/TNPO2 mediate RAM nuclear entry.
23863084 The RNMT N-terminal domain is required for transcript expression, translation and cell proliferation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19161160 Observational study of gene-disease association. (HuGE Navigator)
15767670 Nuclear localization of cap methyltransferase is mediated by alternative nuclear localization signal motifs

AA Sequence

MANSAKAEEYEKMSLEQAKASVNSETESSFNINENTTASGTGLSEKTSVCRQVDIARKRKEFEDDLVKES      1 - 70
SSCGKDTPSKKRKLDPEIVPEEKDCGDAEGNSKKRKRETEDVPKDKSSTGDGTQNKRKIALEDVPEKQKN     71 - 140
LEEGHSSTVAAHYNELQEVGLEKRSQSRIFYLRNFNNWMKSVLIGEFLEKVRQKKKRDITVLDLGCGKGG    141 - 210
DLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDSEYIFSAEFITADSSKELLIDKFRDPQMCFDI    211 - 280
CSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGD    281 - 350
YPLFGCKYDFNLEGVVDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQALEP    351 - 420
YPANESSKLVSEKVDDYEHAAKYMKNSQVRLPLGTLSKSEWEATSIYLVFAFEKQQ                  421 - 476
//

Publication (23)

PMID Year Title
26942677 2016 CDK1-Cyclin B1 Activates RNMT, Coordinating mRNA Cap Methylation with G1 Phase Transcription.
24763612 2014 Genome-wide study of hypomethylated and induced genes in patients with liver cancer unravels novel anticancer targets.
24200467 2014 RAM function is dependent on Kap?2-mediated nuclear entry.
23863084 2013 Human cap methyltransferase (RNMT) N-terminal non-catalytic domain mediates recruitment to transcription initiation sites.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
22099306 2011 RAM/Fam103a1 is required for mRNA cap methylation.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19161160 2009 An association study of 45 folate-related genes in spina bifida: Involvement of cubilin (CUBN) and tRNA aspartic acid methyltransferase 1 (TRDMT1).
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...