Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.93
PubTator Score 1.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 1.03600531863653E-16
psoriasis 6685 3.93185650627971E-4
medulloblastoma, large-cell 6234 0.00149179404007258
oligodendroglioma 2849 0.00328146369855234
astrocytic glioma 2241 0.00398328351653095
glioblastoma 5572 0.0132971889314971
osteosarcoma 7933 0.0238524018604462
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 192 0.0 2.0

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 1.300 0.004
oligodendroglioma 1.100 0.003
psoriasis 1.100 0.000
osteosarcoma 1.126 0.024
glioblastoma -1.200 0.013
medulloblastoma, large-cell -1.500 0.001
lung carcinoma 1.200 0.000

Synonym

Accession O43147 A5LGW2 B4DH69 Q49AC2 Q6ZUY2 Q8IXU4
Symbols RUTBC1

Gene

PANTHER Protein Class (2)

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid
C. elegans OMA Inparanoid

Gene RIF (3)

PMID Text
26620560 Data suggest RUTBC1/SGSM2 in melanocytes functions as physiological GTPase-activating protein for Rab32/Rab38 in regulation of transport of melanogenic enzymes (tyrosinase, tyrosinase-related protein 1, dopachrome isomerase) into melanosomes.
21808068 RUTBC1 is a Tre2/Bub2/Cdc16 domain-containing protein that binds to Rab9A-GTP both in vitro and in cultured cells, but is not a GTPase-activating protein for Rab9A.
17509819 Identification of novel protein SGSM2 which modulate small G protein (RAP and RAB)-mediated signaling pathway

AA Sequence

MGSAEDAVKEKLLWNVKKEVKQIMEEAVTRKFVHEDSSHIIALCGAVEACLLHQLRRRAAGFLRSDKMAA      1 - 70
LFTKVGKTCPVAGEICHKVQELQQQAEGRKPSGVSQEALRRQGSASGKAPALSPQALKHVWVRTALIEKV     71 - 140
LDKVVQYLAENCSKYYEKEALLADPVFGPILASLLVGPCALEYTKLKTADHYWTDPSADELVQRHRIRGP    141 - 210
PTRQDSPAKRPALGIRKRHSSGSASEDRLAACARECVESLHQNSRTRLLYGKNHVLVQPKEDMEAVPGYL    211 - 280
SLHQSAESLTLKWTPNQLMNGTLGDSELEKSVYWDYALVVPFSQVVCIHCHQQKSGGTLVLVSQDGIQRP    281 - 350
PLHFPQGGHLLSFLSCLENGLLPRGQLEPPLWTQQGKGKVFPKLRKRSSIRSVDMEEMGTGRATDYVFRI    351 - 420
IYPGHRHEHNAGDMIEMQGFGPSLPAWHLEPLCSQGSSCLSCSSSSSPHATPSHCSCIPDRLPLRLLCES    421 - 490
MKRQIVSRAFYGWLAHCRHLSTVRTHLSALVHHSVIPPDRPPGASAGLTKDVWSKYQKDKKNYKELELLR    491 - 560
QVYYGGIEHEIRKDVWPFLLGHYKFGMSKKEMEQVDAVVAARYQQVLAEWKACEVVVRQREREAHPATRT    561 - 630
KFSSGSSIDSHVQRLIHRDSTISNDVFISVDDLEPPEPQDPEDSRPKPEQEAGPGTPGTAVVEQQHSVEF    631 - 700
DSPDSGLPSSRNYSVASGIQSSLDEGQSVGFEEEDGGGEEGSSGPGPAAHTLREPQDPSQEKPQAGELEA    701 - 770
GEELAAVCAAAYTIELLDTVALNLHRIDKDVQRCDRNYWYFTPPNLERLRDVMCSYVWEHLDVGYVQGMC    771 - 840
DLLAPLLVTLDNDQLAYSCFSHLMKRMSQNFPNGGAMDTHFANMRSLIQILDSELFELMHQNGDYTHFYF    841 - 910
CYRWFLLDFKRELLYEDVFAVWEVIWAARHISSEHFVLFIALALVEAYREIIRDNNMDFTDIIKFFNERA    911 - 980
EHHDAQEILRIARDLVHKVQMLIENK                                                981 - 1006
//

Text Mined References (14)

PMID Year Title
26620560 2016 RUTBC1 Functions as a GTPase-activating Protein for Rab32/38 and Regulates Melanogenic Enzyme Trafficking in Melanocytes.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
21873549 2011 Genome-wide association identifies nine common variants associated with fasting proinsulin levels and provides new insights into the pathophysiology of type 2 diabetes.
21808068 2011 RUTBC1 protein, a Rab9A effector that activates GTP hydrolysis by Rab32 and Rab33B proteins.
19584346 2009 Genetic variants associated with cardiac structure and function: a meta-analysis and replication of genome-wide association data.
19077034 2009 Identification and characterization of a novel Tre-2/Bub2/Cdc16 (TBC) protein that possesses Rab3A-GAP activity.
17509819 2007 Identification of three novel proteins (SGSM1, 2, 3) which modulate small G protein (RAP and RAB)-mediated signaling pathway.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...