Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.93
PubTator Score 1.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung carcinoma 2843 1.0e-16
psoriasis 6694 3.9e-04
medulloblastoma, large-cell 6241 1.5e-03
oligodendroglioma 2850 3.3e-03
astrocytic glioma 2597 4.0e-03
glioblastoma 5792 1.3e-02
osteosarcoma 7950 2.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 3.0

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 1.300 4.0e-03
glioblastoma -1.200 1.3e-02
lung carcinoma 1.200 1.0e-16
medulloblastoma, large-cell -1.500 1.5e-03
oligodendroglioma 1.100 3.3e-03
osteosarcoma 1.126 2.4e-02
psoriasis 1.100 3.9e-04

Gene RIF (3)

AA Sequence

MGSAEDAVKEKLLWNVKKEVKQIMEEAVTRKFVHEDSSHIIALCGAVEACLLHQLRRRAAGFLRSDKMAA      1 - 70
LFTKVGKTCPVAGEICHKVQELQQQAEGRKPSGVSQEALRRQGSASGKAPALSPQALKHVWVRTALIEKV     71 - 140
LDKVVQYLAENCSKYYEKEALLADPVFGPILASLLVGPCALEYTKLKTADHYWTDPSADELVQRHRIRGP    141 - 210
PTRQDSPAKRPALGIRKRHSSGSASEDRLAACARECVESLHQNSRTRLLYGKNHVLVQPKEDMEAVPGYL    211 - 280
SLHQSAESLTLKWTPNQLMNGTLGDSELEKSVYWDYALVVPFSQVVCIHCHQQKSGGTLVLVSQDGIQRP    281 - 350
PLHFPQGGHLLSFLSCLENGLLPRGQLEPPLWTQQGKGKVFPKLRKRSSIRSVDMEEMGTGRATDYVFRI    351 - 420
IYPGHRHEHNAGDMIEMQGFGPSLPAWHLEPLCSQGSSCLSCSSSSSPHATPSHCSCIPDRLPLRLLCES    421 - 490
MKRQIVSRAFYGWLAHCRHLSTVRTHLSALVHHSVIPPDRPPGASAGLTKDVWSKYQKDKKNYKELELLR    491 - 560
QVYYGGIEHEIRKDVWPFLLGHYKFGMSKKEMEQVDAVVAARYQQVLAEWKACEVVVRQREREAHPATRT    561 - 630
KFSSGSSIDSHVQRLIHRDSTISNDVFISVDDLEPPEPQDPEDSRPKPEQEAGPGTPGTAVVEQQHSVEF    631 - 700
DSPDSGLPSSRNYSVASGIQSSLDEGQSVGFEEEDGGGEEGSSGPGPAAHTLREPQDPSQEKPQAGELEA    701 - 770
GEELAAVCAAAYTIELLDTVALNLHRIDKDVQRCDRNYWYFTPPNLERLRDVMCSYVWEHLDVGYVQGMC    771 - 840
DLLAPLLVTLDNDQLAYSCFSHLMKRMSQNFPNGGAMDTHFANMRSLIQILDSELFELMHQNGDYTHFYF    841 - 910
CYRWFLLDFKRELLYEDVFAVWEVIWAARHISSEHFVLFIALALVEAYREIIRDNNMDFTDIIKFFNERA    911 - 980
EHHDAQEILRIARDLVHKVQMLIENK                                                981 - 1006
//

Text Mined References (14)

PMID Year Title