Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 10.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Disease of anatomical entity 32 0.0 3.0

AA Sequence

MKEALHQIVVRCSELVSSTSLPRLSVSRLQGPPDSQPLGTLGQGGWKLLGIVGSLAPETLGGLGTEFGPC      1 - 70
THPLPFDMVRERERDDELRQGWLLQCPQCARTLLCHCGPFLTPPSQTSSSGFQLCSLKPSGSLVTATEPL     71 - 140
SNFAFSYFP                                                                 141 - 149
//

Text Mined References (4)

PMID Year Title