Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 10.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Disease of anatomical entity 25 2.0

Synonym

Accession O15544
Symbols GR6
C3orf27

Gene

 Compartment GO Term (0)

AA Sequence

MKEALHQIVVRCSELVSSTSLPRLSVSRLQGPPDSQPLGTLGQGGWKLLGIVGSLAPETLGGLGTEFGPC      1 - 70
THPLPFDMVRERERDDELRQGWLLQCPQCARTLLCHCGPFLTPPSQTSSSGFQLCSLKPSGSLVTATEPL     71 - 140
SNFAFSYFP                                                                 141 - 149
//

Text Mined References (4)

PMID Year Title
21738480 2011 Multiple loci are associated with white blood cell phenotypes.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15067727 2004 [Structural features of GR6 gene and its expression in colorectal neoplasm].
9307271 1997 Activation of a novel gene in 3q21 and identification of intergenic fusion transcripts with ecotropic viral insertion site I in leukemia.