Property Summary

NCBI Gene PubMed Count 24
PubMed Score 10.89
PubTator Score 8.36

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
adrenocortical carcinoma 2.233 8.9e-07
diabetes mellitus 1.300 2.2e-03
Duchenne muscular dystrophy 1.058 1.5e-06
malignant mesothelioma -2.400 2.6e-08
osteosarcoma 2.268 4.5e-03
ovarian cancer -2.500 2.9e-10
pancreatic cancer -1.300 1.2e-03
posterior fossa group A ependymoma 1.100 1.9e-06
primary pancreatic ductal adenocarcinoma -1.167 1.5e-03
subependymal giant cell astrocytoma 1.873 4.2e-02

Gene RIF (16)

AA Sequence

MKLWVSALLMAWFGVLSCVQAEFFTSIGHMTDLIYAEKELVQSLKEYILVEEAKLSKIKSWANKMEALTS      1 - 70
KSAADAEGYLAHPVNAYKLVKRLNTDWPALEDLVLQDSAAGFIANLSVQRQFFPTDEDEIGAAKALMRLQ     71 - 140
DTYRLDPGTISRGELPGTKYQAMLSVDDCFGMGRSAYNEGDYYHTVLWMEQVLKQLDAGEEATTTKSQVL    141 - 210
DYLSYAVFQLGDLHRALELTRRLLSLDPSHERAGGNLRYFEQLLEEEREKTLTNQTEAELATPEGIYERP    211 - 280
VDYLPERDVYESLCRGEGVKLTPRRQKRLFCRYHHGNRAPQLLIAPFKEEDEWDSPHIVRYYDVMSDEEI    281 - 350
ERIKEIAKPKLARATVRDPKTGVLTVASYRVSKSSWLEEDDDPVVARVNRRMQHITGLTVKTAELLQVAN    351 - 420
YGVGGQYEPHFDFSRNDERDTFKHLGTGNRVATFLNYMSDVEAGGATVFPDLGAAIWPKKGTAVFWYNLL    421 - 490
RSGEGDYRTRHAACPVLVGCKWVSNKWFHERGQEFLRPCGSTEVD                             491 - 535
//

Text Mined References (26)

PMID Year Title