Property Summary

NCBI Gene PubMed Count 27
Grant Count 57
R01 Count 50
Funding $2,564,815.31
PubMed Score 70.77
PubTator Score 29.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Gene RIF (15)

PMID Text
25041856 inactivation of MSH4 in germ cells may have played a role in the acquisition of additional TP53 and LATS1 germline mutations in a Li-Fraumeni family
24145748 hMSH4 interacts with HDAC3.
23725059 Our current study has revealed a role for hMSH4 in the maintenance of genomic stability by suppressing NHEJ-mediated DSB repair.
21126912 mutation analysis of SYCP3, DNMT3L and MSH4 in patients with maturation arrest of spermatogenesis and couples with recurrent miscarriages
20378615 Observational study of gene-disease association. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18270339 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18166824 Data show that there is no association between MSH4 gene mutation and premature ovarian failure.
18166824 Observational study of gene-disease association. (HuGE Navigator)
17977839 Data have identified the interaction region between the individual subunits of hMSH4-hMSH5 that are likely involved in clamp formation and show that each subunit of the heterodimer binds ATP.
More...

AA Sequence

MLRPEISSTSPSAPAVSPSSGETRSPQGPRYNFGLQETPQSRPSVQVVSASTCPGTSGAAGDRSSSSSSL      1 - 70
PCPAPNSRPAQGSYFGNKRAYAENTVASNFTFGASSSSARDTNYPQTLKTPLSTGNPQRSGYKSWTPQVG     71 - 140
YSASSSSAISAHSPSVIVAVVEGRGLARGEIGMASIDLKNPQIILSQFADNTTYAKVITKLKILSPLEII    141 - 210
MSNTACAVGNSTKLFTLITENFKNVNFTTIQRKYFNETKGLEYIEQLCIAEFSTVLMEVQSKYYCLAAVA    211 - 280
ALLKYVEFIQNSVYAPKSLKICFQGSEQTAMIDSSSAQNLELLINNQDYRNNHTLFGVLNYTKTPGGSRR    281 - 350
LRSNILEPLVDIETINMRLDCVQELLQDEELFFGLQSVISRFLDTEQLLSVLVQIPKQDTVNAAESKITN    351 - 420
LIYLKHTLELVDPLKIAMKNCNTPLLRAYYGSLEDKRFGIILEKIKTVINDDARYMKGCLNMRTQKCYAV    421 - 490
RSNINEFLDIARRTYTEIVDDIAGMISQLGEKYSLPLRTSFSSARGFFIQMTTDCIALPSDQLPSEFIKI    491 - 560
SKVKNSYSFTSADLIKMNERCQESLREIYHMTYMIVCKLLSEIYEHIHCLYKLSDTVSMLDMLLSFAHAC    561 - 630
TLSDYVRPEFTDTLAIKQGWHPILEKISAEKPIANNTYVTEGSNFLIITGPNMSGKSTYLKQIALCQIMA    631 - 700
QIGSYVPAEYSSFRIAKQIFTRISTDDDIETNSSTFMKEMKEIAYILHNANDKSLILIDELGRGTNTEEG    701 - 770
IGICYAVCEYLLSLKAFTLFATHFLELCHIDALYPNVENMHFEVQHVKNTSRNKEAILYTYKLSKGLTEE    771 - 840
KNYGLKAAEVSSLPPSIVLDAKEITTQITRQILQNQRSTPEMERQRAVYHLATRLVQTARNSQLDPDSLR    841 - 910
IYLSNLKKKYKEDFPRTEQVPEKTEE                                                911 - 936
//

Text Mined References (29)

PMID Year Title
25041856 2014 TP53, MSH4, and LATS1 germline mutations in a family with clustering of nervous system tumors.
24145748 2013 DNA damage induced MutS homologue hMSH4 acetylation.
23725059 2013 MutS homologue hMSH4: interaction with eIF3f and a role in NHEJ-mediated DSB repair.
22401567 2012 MutS homologue hMSH5: role in cisplatin-induced DNA damage response.
21126912 2011 Mutation analysis of three genes in patients with maturation arrest of spermatogenesis and couples with recurrent miscarriages.
20378615 2010 Evaluation of 172 candidate polymorphisms for association with oligozoospermia or azoospermia in a large cohort of men of European descent.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18270339 2008 Comprehensive analysis of DNA repair gene variants and risk of meningioma.
18166824 2008 Genetic investigation of four meiotic genes in women with premature ovarian failure.
More...