Property Summary

NCBI Gene PubMed Count 543
PubMed Score 1260.40
PubTator Score 792.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
HIV Infections 102 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6

Expression

  Differential Expression (24)

Disease log2 FC p
active Crohn's disease 1.320 1.4e-02
adult high grade glioma 1.900 3.2e-04
aldosterone-producing adenoma -1.042 2.1e-02
Astrocytoma, Pilocytic 2.500 9.1e-10
Breast cancer -1.400 4.5e-05
breast carcinoma -1.200 1.3e-04
colon cancer -2.400 4.5e-03
cutaneous lupus erythematosus 1.800 1.9e-03
ductal carcinoma in situ -1.100 5.6e-03
Endometriosis -1.375 3.4e-03
ependymoma 2.100 1.5e-13
glioblastoma 2.100 7.2e-09
interstitial cystitis -1.100 2.3e-03
invasive ductal carcinoma -1.100 1.8e-02
juvenile dermatomyositis 1.164 4.8e-10
lung adenocarcinoma -1.300 8.4e-10
lung cancer -1.700 9.2e-03
lung carcinoma -2.500 1.8e-23
malignant mesothelioma -2.000 2.0e-06
non-small cell lung cancer -1.632 1.3e-15
ovarian cancer -2.300 2.2e-06
pituitary cancer 1.200 1.6e-02
subependymal giant cell astrocytoma 1.839 4.7e-02
urothelial carcinoma -1.700 4.9e-02

Protein-protein Interaction (1)

Gene RIF (524)

AA Sequence

MRQTLPCIYFWGGLLPFGMLCASSTTKCTVSHEVADCSHLKLTQVPDDLPTNITVLNLTHNQLRRLPAAN      1 - 70
FTRYSQLTSLDVGFNTISKLEPELCQKLPMLKVLNLQHNELSQLSDKTFAFCTNLTELHLMSNSIQKIKN     71 - 140
NPFVKQKNLITLDLSHNGLSSTKLGTQVQLENLQELLLSNNKIQALKSEELDIFANSSLKKLELSSNQIK    141 - 210
EFSPGCFHAIGRLFGLFLNNVQLGPSLTEKLCLELANTSIRNLSLSNSQLSTTSNTTFLGLKWTNLTMLD    211 - 280
LSYNNLNVVGNDSFAWLPQLEYFFLEYNNIQHLFSHSLHGLFNVRYLNLKRSFTKQSISLASLPKIDDFS    281 - 350
FQWLKCLEHLNMEDNDIPGIKSNMFTGLINLKYLSLSNSFTSLRTLTNETFVSLAHSPLHILNLTKNKIS    351 - 420
KIESDAFSWLGHLEVLDLGLNEIGQELTGQEWRGLENIFEIYLSYNKYLQLTRNSFALVPSLQRLMLRRV    421 - 490
ALKNVDSSPSPFQPLRNLTILDLSNNNIANINDDMLEGLEKLEILDLQHNNLARLWKHANPGGPIYFLKG    491 - 560
LSHLHILNLESNGFDEIPVEVFKDLFELKIIDLGLNNLNTLPASVFNNQVSLKSLNLQKNLITSVEKKVF    561 - 630
GPAFRNLTELDMRFNPFDCTCESIAWFVNWINETHTNIPELSSHYLCNTPPHYHGFPVRLFDTSSCKDSA    631 - 700
PFELFFMINTSILLIFIFIVLLIHFEGWRISFYWNVSVHRVLGFKEIDRQTEQFEYAAYIIHAYKDKDWV    701 - 770
WEHFSSMEKEDQSLKFCLEERDFEAGVFELEAIVNSIKRSRKIIFVITHHLLKDPLCKRFKVHHAVQQAI    771 - 840
EQNLDSIILVFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERIGAFRHKLQVALGSKNSVH          841 - 904
//

Text Mined References (548)

PMID Year Title