Property Summary

NCBI Gene PubMed Count 487
Grant Count 543
R01 Count 244
Funding $59,468,290.77
PubMed Score 1147.21
PubTator Score 792.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
urothelial carcinoma -1.700 0.049
malignant mesothelioma -2.000 0.000
cutaneous lupus erythematosus 1.800 0.002
ependymoma 2.100 0.000
glioblastoma 2.100 0.000
juvenile dermatomyositis 1.581 0.000
non-small cell lung cancer -1.632 0.000
lung cancer -3.300 0.000
colon cancer -2.400 0.005
active Crohn's disease 1.320 0.014
breast carcinoma -1.200 0.000
interstitial cystitis -1.200 0.002
lung adenocarcinoma -1.300 0.000
pediatric high grade glioma 2.200 0.000
pilocytic astrocytoma 2.400 0.000
aldosterone-producing adenoma -1.366 0.006
subependymal giant cell astrocytoma 1.839 0.047
Endometriosis -1.375 0.003
lung carcinoma -2.500 0.000
Breast cancer -1.400 0.000
ductal carcinoma in situ -1.500 0.005
invasive ductal carcinoma -1.900 0.003
ovarian cancer -2.300 0.000
pituitary cancer 1.200 0.016

Synonym

Accession O15455 B2RAI7 B7Z7K0 E6Y0F0 E6Y0F1 E9PGH4 Q4VAL2 Q504W0
Symbols CD283
IIAE2

Gene

PANTHER Protein Class (1)

PDB

1ZIW   2A0Z   2MK9   2MKA   3ULU   3ULV  

Gene RIF (467)

PMID Text
26797279 Based on the collective findings, we suggest that vIRF2 acts as an activator in PI3K/Akt pathway.
26646717 Using bone marrow derived macrophages from knockout mice we demonstrate that hBD3 suppresses the polyI:C-induced TLR3 response mediated by TICAM1 (TRIF), while exacerbating the cytoplasmic response through MDA5 (IFIH1) and MAVS (IPS1/CARDIF).
26589477 TLR3 activation increases chemokine expression in human fetal airway smooth muscle cells
26584291 TLR3 polymorphisms are unlikely to play a significant role in the development of preeclampsia in the Chinese Han population.
26536229 High TLR3 expression is associated with Inflammatory Bowel Disease.
26512422 Study found TLR3 and IFNgamma to play an important role in Hepatitis E pathogenesis. Patients expressing high levels of TLR 3 and robust IFNgamma response are able to recover from the disease; while those with lower expression progress to acute liver failure.
26466955 Knockdown of LRRC59 reduced TLR3-, 8-, and 9-mediated, but not TLR4-mediated, signaling.
26418032 Data indicate that interleukin-17 (IL-17A) and toll like receptor 3 (TLR3) activation cooperate to induce proinflammatory responses in the airway epithelium.
26417991 role of TLR3/BAFF axis in IgA class-switch recombination of IgA nephropathy
26367324 The anti-viral effect of IL-24 correlated with caspase-3 activation and could be blocked by a pan-caspase inhibitor and by small interfering RNA (siRNA) directed towards TLR3.
More...

AA Sequence

MRQTLPCIYFWGGLLPFGMLCASSTTKCTVSHEVADCSHLKLTQVPDDLPTNITVLNLTHNQLRRLPAAN      1 - 70
FTRYSQLTSLDVGFNTISKLEPELCQKLPMLKVLNLQHNELSQLSDKTFAFCTNLTELHLMSNSIQKIKN     71 - 140
NPFVKQKNLITLDLSHNGLSSTKLGTQVQLENLQELLLSNNKIQALKSEELDIFANSSLKKLELSSNQIK    141 - 210
EFSPGCFHAIGRLFGLFLNNVQLGPSLTEKLCLELANTSIRNLSLSNSQLSTTSNTTFLGLKWTNLTMLD    211 - 280
LSYNNLNVVGNDSFAWLPQLEYFFLEYNNIQHLFSHSLHGLFNVRYLNLKRSFTKQSISLASLPKIDDFS    281 - 350
FQWLKCLEHLNMEDNDIPGIKSNMFTGLINLKYLSLSNSFTSLRTLTNETFVSLAHSPLHILNLTKNKIS    351 - 420
KIESDAFSWLGHLEVLDLGLNEIGQELTGQEWRGLENIFEIYLSYNKYLQLTRNSFALVPSLQRLMLRRV    421 - 490
ALKNVDSSPSPFQPLRNLTILDLSNNNIANINDDMLEGLEKLEILDLQHNNLARLWKHANPGGPIYFLKG    491 - 560
LSHLHILNLESNGFDEIPVEVFKDLFELKIIDLGLNNLNTLPASVFNNQVSLKSLNLQKNLITSVEKKVF    561 - 630
GPAFRNLTELDMRFNPFDCTCESIAWFVNWINETHTNIPELSSHYLCNTPPHYHGFPVRLFDTSSCKDSA    631 - 700
PFELFFMINTSILLIFIFIVLLIHFEGWRISFYWNVSVHRVLGFKEIDRQTEQFEYAAYIIHAYKDKDWV    701 - 770
WEHFSSMEKEDQSLKFCLEERDFEAGVFELEAIVNSIKRSRKIIFVITHHLLKDPLCKRFKVHHAVQQAI    771 - 840
EQNLDSIILVFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERIGAFRHKLQVALGSKNSVH          841 - 904
//

Text Mined References (492)

PMID Year Title
26797279 2016 Activation of the phosphatidylinositol 3-kinase/Akt pathway by viral interferon regulatory factor 2 of Kaposi's sarcoma-associated herpesvirus.
26646717 2015 Human ?-Defensin 3 [corrected] Exacerbates MDA5 but Suppresses TLR3 Responses to the Viral Molecular Pattern Mimic Polyinosinic:Polycytidylic Acid.
26589477 2016 TLR3 activation increases chemokine expression in human fetal airway smooth muscle cells.
26584291 2015 Role of Toll-Like Receptor 3 Gene Polymorphisms in Preeclampsia.
26536229 2015 Expression of CCL20 and Its Corresponding Receptor CCR6 Is Enhanced in Active Inflammatory Bowel Disease, and TLR3 Mediates CCL20 Expression in Colonic Epithelial Cells.
26512422 2015 Role of TLR gene expression and cytokine profiling in the immunopathogenesis of viral hepatitis E.
26466955 2015 LRRC59 Regulates Trafficking of Nucleic Acid-Sensing TLRs from the Endoplasmic Reticulum via Association with UNC93B1.
26418032 2015 Synergistic Proinflammatory Responses by IL-17A and Toll-Like Receptor 3 in Human Airway Epithelial Cells.
26417991 2015 Synthetic Double-Stranded RNA Poly(I:C) Aggravates IgA Nephropathy by Triggering IgA Class Switching Recombination through the TLR3-BAFF Axis.
26367324 2015 Interleukin-24 inhibits influenza A virus replication in vitro through induction of toll-like receptor 3 dependent apoptosis.
More...