Property Summary

NCBI Gene PubMed Count 18
PubMed Score 0.00
PubTator Score 7.58

Knowledge Summary

Patent

No data available

Synonym

Accession O15453 Q3LRJ7
Symbols NCRNA00192

Gene

 Compartment GO Term (0)

Gene RIF (4)

AA Sequence

MWKGGRSHPFLPCSSRRAGSGGQLDSILPHQSPAWGPWGCKDLSSGVPSFLTSSILWKSAVFAEDNGLKI      1 - 70
HLCSYKRDDLVLFYDCTSFVLTFGPSPWFLTQGFLNPLEFSA                                 71 - 112
//

Text Mined References (19)

PMID Year Title