Property Summary

NCBI Gene PubMed Count 17
PubMed Score 0.00
PubTator Score 7.58

Knowledge Summary

Patent

No data available

Synonym

Accession O15453 Q3LRJ7
Symbols NCRNA00192

Gene

 Compartment GO Term (0)

Gene RIF (2)

PMID Text
27792451 Data indicate that long non-coding RNAs (lncRNAs) NBR2 (neighbour of BRCA1 gene 2) modulates cancer cell sensitivity to phenformin through NBR2 regulation of GLUT1 expression at transcriptional level.
26999735 Data indicate that long non-coding RNAs (lncRNAs) NBR2 (neighbour of BRCA1 gene 2) interacts with AMP-activated kinase (AMPK) and promotes AMPK kinase activity during energy stress.

AA Sequence

MWKGGRSHPFLPCSSRRAGSGGQLDSILPHQSPAWGPWGCKDLSSGVPSFLTSSILWKSAVFAEDNGLKI      1 - 70
HLCSYKRDDLVLFYDCTSFVLTFGPSPWFLTQGFLNPLEFSA                                 71 - 112
//

Text Mined References (18)

PMID Year Title
27792451 2016 lncRNA NBR2 modulates cancer cell sensitivity to phenformin through GLUT1.
27152502 2016 An lncRNA switch for AMPK activation.
26999735 2016 LncRNA NBR2 engages a metabolic checkpoint by regulating AMPK under energy stress.
24667779 2014 Functional characterization of BRCA1 gene variants by mini-gene splicing assay.
21989022 2011 A de novo complete BRCA1 gene deletion identified in a Spanish woman with early bilateral breast cancer.
16438707 2006 Comparative analysis of cancer genes in the human and chimpanzee genomes.
16052033 2005 Specific binding of the methyl binding domain protein 2 at the BRCA1-NBR2 locus.
15777733 2005 Model of transcriptional regulation of the BRCA1-NBR2 bi-directional transcriptional unit.
15533724 2004 Structural evolution of the BRCA1 genomic region in primates.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...