Property Summary

NCBI Gene PubMed Count 30
PubMed Score 17.36
PubTator Score 31.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count
Leprosy 77

Expression

Synonym

Accession O15389 Siglec-5
Symbols CD170
OBBP2
CD33L2
OB-BP2
SIGLEC-5

Gene

PDB

2ZG1   2ZG2   2ZG3  

  Ortholog (2)

Species Source
Macaque OMA Inparanoid
Pig OMA Inparanoid

 GWAS Trait (1)

Gene RIF (16)

PMID Text
26459514 An unbiased screen revealed Hsp70 as a ligand for Siglec-5 and Siglec-14. Hsp70 stimulation through Siglec-5 delivers an anti-inflammatory signal, while stimulation through Siglec-14 is pro-inflammatory.
24799499 Data indicate that the Siglec-5/14 genotype influences neutrophil responses to group B Streptococcus.
24068891 we found that secretory IgA is taken up by M cells via the Dectin-1 receptor, with the possible involvement of Siglec-5 acting as a co-receptor.
23321067 These studies demonstrate the Siglec5 carbohydrate recognition domain alone is sufficient for binding sialylated carbohydrates and provide a foundation for further investigation of Siglec5 structure and function.
22945238 Siglec-5 expression protects T cells from HIV-1- and apoptosis-induced cell death and contributes to the different outcomes of HIV-1 infection in humans and chimpanzees.
21795693 Human Siglec-5 inhibitory receptor and immunoglobulin A (IgA) have separate binding sites in streptococcal beta protein.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20231688 Siglec-5 expression correlates with lack of proliferation in a subset of human cells, and is upregulated by activation of chimpanzee but not human lymphocytes.
19596804 Group B Streptococcus beta protein binding to Siglec-5 functions to impair leukocyte phagocytosis, oxidative burst, and extracellular trap production, promoting bacterial survival.
18022638 Structural implications of SIGLEC5-mediated sialoglycan recognition are reported.
More...

AA Sequence

MLPLLLLPLLWGGSLQEKPVYELQVQKSVTVQEGLCVLVPCSFSYPWRSWYSSPPLYVYWFRDGEIPYYA      1 - 70
EVVATNNPDRRVKPETQGRFRLLGDVQKKNCSLSIGDARMEDTGSYFFRVERGRDVKYSYQQNKLNLEVT     71 - 140
ALIEKPDIHFLEPLESGRPTRLSCSLPGSCEAGPPLTFSWTGNALSPLDPETTRSSELTLTPRPEDHGTN    141 - 210
LTCQMKRQGAQVTTERTVQLNVSYAPQTITIFRNGIALEILQNTSYLPVLEGQALRLLCDAPSNPPAHLS    211 - 280
WFQGSPALNATPISNTGILELRRVRSAEEGGFTCRAQHPLGFLQIFLNLSVYSLPQLLGPSCSWEAEGLH    281 - 350
CRCSFRARPAPSLCWRLEEKPLEGNSSQGSFKVNSSSAGPWANSSLILHGGLSSDLKVSCKAWNIYGSQS    351 - 420
GSVLLLQGRSNLGTGVVPAALGGAGVMALLCICLCLIFFLIVKARRKQAAGRPEKMDDEDPIMGTITSGS    421 - 490
RKKPWPDSPGDQASPPGDAPPLEEQKELHYASLSFSEMKSREPKDQEAPSTTEYSEIKTSK             491 - 551
//

Text Mined References (30)

PMID Year Title
26459514 2015 Immunomodulatory activity of extracellular Hsp70 mediated via paired receptors Siglec-5 and Siglec-14.
25642632 2015 Discovery of six new susceptibility loci and analysis of pleiotropic effects in leprosy.
25416956 2014 A proteome-scale map of the human interactome network.
24799499 2014 Siglec-5 and Siglec-14 are polymorphic paired receptors that modulate neutrophil and amnion signaling responses to group B Streptococcus.
24068891 2013 Dectin-1 is essential for reverse transcytosis of glycosylated SIgA-antigen complexes by intestinal M cells.
23321067 2013 Refolded recombinant Siglec5 for NMR investigation of complex carbohydrate binding.
22945238 2013 Cell-intrinsic mechanism involving Siglec-5 associated with divergent outcomes of HIV-1 infection in human and chimpanzee CD4 T cells.
22215570 2012 Leukocyte inflammatory responses provoked by pneumococcal sialidase.
21795693 2011 Human Siglec-5 inhibitory receptor and immunoglobulin A (IgA) have separate binding sites in streptococcal beta protein.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
More...