Property Summary

NCBI Gene PubMed Count 30
Grant Count 18
Funding $1,252,999.39
PubMed Score 17.36
PubTator Score 31.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Leprosy 77

Expression

Gene RIF (16)

PMID Text
26459514 An unbiased screen revealed Hsp70 as a ligand for Siglec-5 and Siglec-14. Hsp70 stimulation through Siglec-5 delivers an anti-inflammatory signal, while stimulation through Siglec-14 is pro-inflammatory.
24799499 Data indicate that the Siglec-5/14 genotype influences neutrophil responses to group B Streptococcus.
24068891 we found that secretory IgA is taken up by M cells via the Dectin-1 receptor, with the possible involvement of Siglec-5 acting as a co-receptor.
23321067 These studies demonstrate the Siglec5 carbohydrate recognition domain alone is sufficient for binding sialylated carbohydrates and provide a foundation for further investigation of Siglec5 structure and function.
22945238 Siglec-5 expression protects T cells from HIV-1- and apoptosis-induced cell death and contributes to the different outcomes of HIV-1 infection in humans and chimpanzees.
21795693 Human Siglec-5 inhibitory receptor and immunoglobulin A (IgA) have separate binding sites in streptococcal beta protein.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20231688 Siglec-5 expression correlates with lack of proliferation in a subset of human cells, and is upregulated by activation of chimpanzee but not human lymphocytes.
19596804 Group B Streptococcus beta protein binding to Siglec-5 functions to impair leukocyte phagocytosis, oxidative burst, and extracellular trap production, promoting bacterial survival.
18022638 Structural implications of SIGLEC5-mediated sialoglycan recognition are reported.
More...

AA Sequence

MLPLLLLPLLWGGSLQEKPVYELQVQKSVTVQEGLCVLVPCSFSYPWRSWYSSPPLYVYWFRDGEIPYYA      1 - 70
EVVATNNPDRRVKPETQGRFRLLGDVQKKNCSLSIGDARMEDTGSYFFRVERGRDVKYSYQQNKLNLEVT     71 - 140
ALIEKPDIHFLEPLESGRPTRLSCSLPGSCEAGPPLTFSWTGNALSPLDPETTRSSELTLTPRPEDHGTN    141 - 210
LTCQMKRQGAQVTTERTVQLNVSYAPQTITIFRNGIALEILQNTSYLPVLEGQALRLLCDAPSNPPAHLS    211 - 280
WFQGSPALNATPISNTGILELRRVRSAEEGGFTCRAQHPLGFLQIFLNLSVYSLPQLLGPSCSWEAEGLH    281 - 350
CRCSFRARPAPSLCWRLEEKPLEGNSSQGSFKVNSSSAGPWANSSLILHGGLSSDLKVSCKAWNIYGSQS    351 - 420
GSVLLLQGRSNLGTGVVPAALGGAGVMALLCICLCLIFFLIVKARRKQAAGRPEKMDDEDPIMGTITSGS    421 - 490
RKKPWPDSPGDQASPPGDAPPLEEQKELHYASLSFSEMKSREPKDQEAPSTTEYSEIKTSK             491 - 551
//

Text Mined References (30)

PMID Year Title
26459514 2015 Immunomodulatory activity of extracellular Hsp70 mediated via paired receptors Siglec-5 and Siglec-14.
25642632 2015 Discovery of six new susceptibility loci and analysis of pleiotropic effects in leprosy.
25416956 2014 A proteome-scale map of the human interactome network.
24799499 2014 Siglec-5 and Siglec-14 are polymorphic paired receptors that modulate neutrophil and amnion signaling responses to group B Streptococcus.
24068891 2013 Dectin-1 is essential for reverse transcytosis of glycosylated SIgA-antigen complexes by intestinal M cells.
23321067 2013 Refolded recombinant Siglec5 for NMR investigation of complex carbohydrate binding.
22945238 2013 Cell-intrinsic mechanism involving Siglec-5 associated with divergent outcomes of HIV-1 infection in human and chimpanzee CD4 T cells.
22215570 2012 Leukocyte inflammatory responses provoked by pneumococcal sialidase.
21795693 2011 Human Siglec-5 inhibitory receptor and immunoglobulin A (IgA) have separate binding sites in streptococcal beta protein.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
More...