Property Summary

NCBI Gene PubMed Count 24
PubMed Score 27.29
PubTator Score 15.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 7.23297521439077E-5
group 3 medulloblastoma 2254 1.36728055589359E-4
lung cancer 4473 6.04841452352725E-4
colon cancer 1475 8.0338146573426E-4
Disease Target Count Z-score Confidence
Crohn's disease 304 0.0 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
colon cancer 1.200 0.001
lung cancer 1.300 0.001
group 3 medulloblastoma 1.100 0.000
ovarian cancer 1.300 0.000

Synonym

Accession O15355
Symbols PP2CG
PPP2CG
PP2CGAMMA

Gene

  Ortholog (12)

Species Source
Chimp OMA Inparanoid
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA Inparanoid

Gene RIF (15)

PMID Text
26324325 PPM1G phosphatase directly binds 7SK RNA and the kinase inhibitor Hexim1 once P-TEFb has been released from the 7SK snRNP.
25982659 Hypermethylation in the 3'-protein-phosphatase-1G (PPM1G) gene locus was associated with alcohol use disorder.
25071155 PPM1G inactivates monomeric WWP2 and promotes the assembly of WWP2-WWP1 heterodimeric complex.
24316072 PPM1G dephosphorylates the P-TEFb kinase T loop to disassemble the 7SK snRNP.
24316072 Loss of PPM1G expression by siRNA results in downregulation of HIV-1 Gag production in cells and CA in virions, indicating that HIV-1 transcription is regulated by PPM1G
23814053 study has identified protein phosphatase PPM1G as a novel regulator of cap-dependent protein translation by negatively controlling the phosphorylation of 4E-BP1.
22361354 ATM-dependent downregulation of USP7/HAUSP by PPM1G activates p53 response to DNA damage
22190034 Loss of PPM1G expression by siRNA results in downregulation of HIV-1 Gag production in cells and CA in virions, indicating that HIV-1 transcription is regulated by PPM1G
20468071 Observational study of gene-disease association. (HuGE Navigator)
19538940 PP2Cgamma is a novel regulator of p21(Cip1/WAF1) protein stability via the Akt signaling pathway.
More...

AA Sequence

MGAYLSQPNTVKCSGDGVGAPRLPLPYGFSAMQGWRVSMEDAHNCIPELDSETAMFSVYDGHGGEEVALY      1 - 70
CAKYLPDIIKDQKAYKEGKLQKALEDAFLAIDAKLTTEEVIKELAQIAGRPTEDEDEKEKVADEDDVDNE     71 - 140
EAALLHEEATMTIEELLTRYGQNCHKGPPHSKSGGGTGEEPGSQGLNGEAGPEDSTRETPSQENGPTAKA    141 - 210
YTGFSSNSERGTEAGQVGEPGIPTGEAGPSCSSASDKLPRVAKSKFFEDSEDESDEAEEEEEDSEECSEE    211 - 280
EDGYSSEEAENEEDEDDTEEAEEDDEEEEEEMMVPGMEGKEEPGSDSGTTAVVALIRGKQLIVANAGDSR    281 - 350
CVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNKNLPPEEQMISA    351 - 420
LPDIKVLTLTDDHEFMVIACDGIWNVMSSQEVVDFIQSKISQRDENGELRLLSSIVEELLDQCLAPDTSG    421 - 490
DGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSDKKKKAKRD                  491 - 546
//

Text Mined References (36)

PMID Year Title
26324325 2015 PPM1G Binds 7SK RNA and Hexim1 To Block P-TEFb Assembly into the 7SK snRNP and Sustain Transcription Elongation.
25982659 2015 Association of Protein Phosphatase PPM1G With Alcohol Use Disorder and Brain Activity During Behavioral Control in a Genome-Wide Methylation Analysis.
25807930 2015 Multifunctional reagents for quantitative proteome-wide analysis of protein modification in human cells and dynamic profiling of protein lipidation during vertebrate development.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
25071155 2014 WWP2-WWP1 ubiquitin ligase complex coordinated by PPM1G maintains the balance between cellular p73 and ?Np73 levels.
24316072 2013 Transcription factors mediate the enzymatic disassembly of promoter-bound 7SK snRNP to locally recruit P-TEFb for transcription elongation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23814053 2013 Protein phosphatase PPM1G regulates protein translation and cell growth by dephosphorylating 4E binding protein 1 (4E-BP1).
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
More...