Property Summary

NCBI Gene PubMed Count 24
Grant Count 1
R01 Count 1
Funding $99,339.5
PubMed Score 27.29
PubTator Score 15.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
colon cancer 1.200 0.001
lung cancer 1.300 0.001
group 3 medulloblastoma 1.100 0.000
ovarian cancer 1.300 0.000

Synonym

Accession O15355
Symbols PP2CG
PPP2CG
PP2CGAMMA

Gene

 Grant Application (1)

Gene RIF (19)

PMID Text
26324325 PPM1G phosphatase directly binds 7SK RNA and the kinase inhibitor Hexim1 once P-TEFb has been released from the 7SK snRNP.
25982659 Hypermethylation in the 3'-protein-phosphatase-1G (PPM1G) gene locus was associated with alcohol use disorder.
25071155 PPM1G inactivates monomeric WWP2 and promotes the assembly of WWP2-WWP1 heterodimeric complex.
24316072 PPM1G dephosphorylates the P-TEFb kinase T loop to disassemble the 7SK snRNP.
24316072 Loss of PPM1G expression by siRNA results in downregulation of HIV-1 Gag production in cells and CA in virions, indicating that HIV-1 transcription is regulated by PPM1G
24316072 Loss of PPM1G expression by siRNA results in downregulation of HIV-1 Gag production in cells and CA in virions, indicating that HIV-1 transcription is regulated by PPM1G
24316072 Loss of PPM1G expression by siRNA results in downregulation of HIV-1 Gag production in cells and CA in virions, indicating that HIV-1 transcription is regulated by PPM1G
24316072 Loss of PPM1G expression by siRNA results in downregulation of HIV-1 Gag production in cells and CA in virions, indicating that HIV-1 transcription is regulated by PPM1G
24316072 Loss of PPM1G expression by siRNA results in downregulation of HIV-1 Gag production in cells and CA in virions, indicating that HIV-1 transcription is regulated by PPM1G
23814053 study has identified protein phosphatase PPM1G as a novel regulator of cap-dependent protein translation by negatively controlling the phosphorylation of 4E-BP1.
More...

AA Sequence

MGAYLSQPNTVKCSGDGVGAPRLPLPYGFSAMQGWRVSMEDAHNCIPELDSETAMFSVYDGHGGEEVALY      1 - 70
CAKYLPDIIKDQKAYKEGKLQKALEDAFLAIDAKLTTEEVIKELAQIAGRPTEDEDEKEKVADEDDVDNE     71 - 140
EAALLHEEATMTIEELLTRYGQNCHKGPPHSKSGGGTGEEPGSQGLNGEAGPEDSTRETPSQENGPTAKA    141 - 210
YTGFSSNSERGTEAGQVGEPGIPTGEAGPSCSSASDKLPRVAKSKFFEDSEDESDEAEEEEEDSEECSEE    211 - 280
EDGYSSEEAENEEDEDDTEEAEEDDEEEEEEMMVPGMEGKEEPGSDSGTTAVVALIRGKQLIVANAGDSR    281 - 350
CVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNKNLPPEEQMISA    351 - 420
LPDIKVLTLTDDHEFMVIACDGIWNVMSSQEVVDFIQSKISQRDENGELRLLSSIVEELLDQCLAPDTSG    421 - 490
DGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSDKKKKAKRD                  491 - 546
//

Text Mined References (36)

PMID Year Title
26324325 2015 PPM1G Binds 7SK RNA and Hexim1 To Block P-TEFb Assembly into the 7SK snRNP and Sustain Transcription Elongation.
25982659 2015 Association of Protein Phosphatase PPM1G With Alcohol Use Disorder and Brain Activity During Behavioral Control in a Genome-Wide Methylation Analysis.
25807930 2015 Multifunctional reagents for quantitative proteome-wide analysis of protein modification in human cells and dynamic profiling of protein lipidation during vertebrate development.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
25071155 2014 WWP2-WWP1 ubiquitin ligase complex coordinated by PPM1G maintains the balance between cellular p73 and ?Np73 levels.
24316072 2013 Transcription factors mediate the enzymatic disassembly of promoter-bound 7SK snRNP to locally recruit P-TEFb for transcription elongation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23814053 2013 Protein phosphatase PPM1G regulates protein translation and cell growth by dephosphorylating 4E binding protein 1 (4E-BP1).
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
More...