Property Summary

NCBI Gene PubMed Count 25
PubMed Score 27.97
PubTator Score 15.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
alcohol use disorder 12
Disease Target Count P-value
ovarian cancer 8520 7.2e-05
group 3 medulloblastoma 4104 1.4e-04
lung cancer 4740 6.0e-04
colon cancer 1478 8.0e-04
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0

Expression

  Differential Expression (4)

Disease log2 FC p
colon cancer 1.200 8.0e-04
group 3 medulloblastoma 1.100 1.4e-04
lung cancer 1.300 6.0e-04
ovarian cancer 1.300 7.2e-05

Gene RIF (15)

AA Sequence

MGAYLSQPNTVKCSGDGVGAPRLPLPYGFSAMQGWRVSMEDAHNCIPELDSETAMFSVYDGHGGEEVALY      1 - 70
CAKYLPDIIKDQKAYKEGKLQKALEDAFLAIDAKLTTEEVIKELAQIAGRPTEDEDEKEKVADEDDVDNE     71 - 140
EAALLHEEATMTIEELLTRYGQNCHKGPPHSKSGGGTGEEPGSQGLNGEAGPEDSTRETPSQENGPTAKA    141 - 210
YTGFSSNSERGTEAGQVGEPGIPTGEAGPSCSSASDKLPRVAKSKFFEDSEDESDEAEEEEEDSEECSEE    211 - 280
EDGYSSEEAENEEDEDDTEEAEEDDEEEEEEMMVPGMEGKEEPGSDSGTTAVVALIRGKQLIVANAGDSR    281 - 350
CVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNKNLPPEEQMISA    351 - 420
LPDIKVLTLTDDHEFMVIACDGIWNVMSSQEVVDFIQSKISQRDENGELRLLSSIVEELLDQCLAPDTSG    421 - 490
DGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSDKKKKAKRD                  491 - 546
//

Text Mined References (37)

PMID Year Title