Property Summary

NCBI Gene PubMed Count 114
Grant Count 402
R01 Count 204
Funding $65,668,217.88
PubMed Score 916.62
PubTator Score 480.70

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O15294 Q7Z3K0 Q8WWM8 Q96CC1 Q9UG57
Symbols HRNT1
HINCUT-1
O-GLCNAC

Gene

OGT

PANTHER Protein Class (2)

PDB

4N39   4N3A   4N3B   4N3C   1W3B   3PE3   3PE4   3TAX   4AY5   4AY6   4CDR   4GYW   4GYY   4GZ3   4GZ5   4GZ6   4XI9   4XIF   5BNW   5C1D   5HGV  

Gene RIF (67)

PMID Text
26854602 Together, these findings suggest that induction of SNO-OGT by Ab exposure is a pathogenic mechanism to cause cellular hypo-O-GlcNAcylation by which Ab neurotoxicity is executed
26807597 Data suggest RNA polymerase II (POLR2A) is extensively modified on its unique C-terminal domain (CTD) by O-GlcNAc transferase (OGT); efficient O-GlcNAcylation requires a minimum of 20 heptad CTD repeats in POLR2A and more than half of NTD of OGT.
26707622 OGT inhibited the formation of the Ecadherin/catenin complex through reducing the interaction between p120 and Ecadherin.
26527687 E2F1 negatively regulates both Ogt and Mgea5 expression in an Rb1 protein-dependent manner.
26408091 a new function of histone O-GlcNAcylation in DNA damage response
26399441 OGT expression is increased under hypoxic conditions.
26397041 We concluded that OGT plays a key role in gastric cancer proliferation and survival, and could be a potential target for therapy.
26305326 These results demonstrate that distinct OGT-binding sites in HCF-1 promote proteolysis, and provide novel insights into the mechanism of this unusual protease activity.
26252736 These results suggested roles of O-GlcNAcylation in modulating serine phosphorylation, as well as in regulating PKM2 activity and expression.
26240142 Use of OGT(C917A) enhances O-GlcNDAz production, yielding improved cross-linking of O-GlcNDAz-modified molecules
More...

AA Sequence

MASSVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRR      1 - 70
LDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDME     71 - 140
GAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLA    141 - 210
IHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAID    211 - 280
TYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLY    281 - 350
RKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTR    351 - 420
AIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLV    421 - 490
SIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGY    491 - 560
VSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQ    561 - 630
DGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMP    631 - 700
HTFFIGDHANMFPHLKKKAVIDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNADSSNT    701 - 770
ALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPED    771 - 840
AIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEE    841 - 910
HVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIA    911 - 980
VKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA        981 - 1046
//

Text Mined References (126)

PMID Year Title
26854602 2016 A?-affected pathogenic induction of S-nitrosylation of OGT and identification of Cys-NO linkage triplet.
26807597 2016 Distributive O-GlcNAcylation on the Highly Repetitive C-Terminal Domain of RNA Polymerase II.
26707622 2016 Inhibition of E-cadherin/catenin complex formation by O-linked N-acetylglucosamine transferase is partially independent of its catalytic activity.
26527687 2015 E2F1 Transcription Factor Regulates O-linked N-acetylglucosamine (O-GlcNAc) Transferase and O-GlcNAcase Expression.
26408091 2015 OGT mediated histone H2B S112 GlcNAcylation regulates DNA damage response.
26399441 2015 O-GlcNAcylation of G6PD promotes the pentose phosphate pathway and tumor growth.
26397041 2015 Silencing ?-linked N-acetylglucosamine transferase induces apoptosis in human gastric cancer cells through PUMA and caspase-3 pathways.
26305326 2015 Distinct OGT-Binding Sites Promote HCF-1 Cleavage.
26273451 2015 Nonsyndromic X-linked intellectual deficiency in three brothers with a novel MED12 missense mutation [c.5922G>T (p.Glu1974His)].
26252736 2015 Alteration of O-GlcNAcylation affects serine phosphorylation and regulates gene expression and activity of pyruvate kinase M2 in colorectal cancer cells.
More...