Property Summary

NCBI Gene PubMed Count 141
PubMed Score 551.28
PubTator Score 497.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Obesity 678 0.0 2.2
Disease Target Count Z-score Confidence
Niemann-Pick disease 14 7.816 3.9
Disease Target Count
Niemann-Pick Disease, Type C1 1

Expression

  Differential Expression (12)

Disease log2 FC p
adrenocortical carcinoma -1.988 1.1e-05
Down syndrome 1.300 1.8e-03
Gaucher disease type 1 -1.200 1.7e-02
group 4 medulloblastoma -1.400 8.6e-04
lung cancer -1.900 8.2e-03
lung carcinoma -1.500 2.9e-26
medulloblastoma, large-cell -1.100 7.4e-04
osteosarcoma 2.291 4.3e-05
ovarian cancer 1.300 1.7e-04
pancreatic cancer 1.300 2.2e-04
psoriasis 1.500 1.0e-03
tuberculosis -1.300 9.4e-05

Gene RIF (117)

AA Sequence

MTARGLALGLLLLLLCPAQVFSQSCVWYGECGIAYGDKRYNCEYSGPPKPLPKDGYDLVQELCPGFFFGN      1 - 70
VSLCCDVRQLQTLKDNLQLPLQFLSRCPSCFYNLLNLFCELTCSPRQSQFLNVTATEDYVDPVTNQTKTN     71 - 140
VKELQYYVGQSFANAMYNACRDVEAPSSNDKALGLLCGKDADACNATNWIEYMFNKDNGQAPFTITPVFS    141 - 210
DFPVHGMEPMNNATKGCDESVDEVTAPCSCQDCSIVCGPKPQPPPPPAPWTILGLDAMYVIMWITYMAFL    211 - 280
LVFFGAFFAVWCYRKRYFVSEYTPIDSNIAFSVNASDKGEASCCDPVSAAFEGCLRRLFTRWGSFCVRNP    281 - 350
GCVIFFSLVFITACSSGLVFVRVTTNPVDLWSAPSSQARLEKEYFDQHFGPFFRTEQLIIRAPLTDKHIY    351 - 420
QPYPSGADVPFGPPLDIQILHQVLDLQIAIENITASYDNETVTLQDICLAPLSPYNTNCTILSVLNYFQN    421 - 490
SHSVLDHKKGDDFFVYADYHTHFLYCVRAPASLNDTSLLHDPCLGTFGGPVFPWLVLGGYDDQNYNNATA    491 - 560
LVITFPVNNYYNDTEKLQRAQAWEKEFINFVKNYKNPNLTISFTAERSIEDELNRESDSDVFTVVISYAI    561 - 630
MFLYISLALGHMKSCRRLLVDSKVSLGIAGILIVLSSVACSLGVFSYIGLPLTLIVIEVIPFLVLAVGVD    631 - 700
NIFILVQAYQRDERLQGETLDQQLGRVLGEVAPSMFLSSFSETVAFFLGALSVMPAVHTFSLFAGLAVFI    701 - 770
DFLLQITCFVSLLGLDIKRQEKNRLDIFCCVRGAEDGTSVQASESCLFRFFKNSYSPLLLKDWMRPIVIA    771 - 840
IFVGVLSFSIAVLNKVDIGLDQSLSMPDDSYMVDYFKSISQYLHAGPPVYFVLEEGHDYTSSKGQNMVCG    841 - 910
GMGCNNDSLVQQIFNAAQLDNYTRIGFAPSSWIDDYFDWVKPQSSCCRVDNITDQFCNASVVDPACVRCR    911 - 980
PLTPEGKQRPQGGDFMRFLPMFLSDNPNPKCGKGGHAAYSSAVNILLGHGTRVGATYFMTYHTVLQTSAD    981 - 1050
FIDALKKARLIASNVTETMGINGSAYRVFPYSVFYVFYEQYLTIIDDTIFNLGVSLGAIFLVTMVLLGCE   1051 - 1120
LWSAVIMCATIAMVLVNMFGVMWLWGISLNAVSLVNLVMSCGISVEFCSHITRAFTVSMKGSRVERAEEA   1121 - 1190
LAHMGSSVFSGITLTKFGGIVVLAFAKSQIFQIFYFRMYLAMVLLGATHGLIFLPVLLSYIGPSVNKAKS   1191 - 1260
CATEERYKGTERERLLNF                                                       1261 - 1278
//

Text Mined References (156)

PMID Year Title