Property Summary

NCBI Gene PubMed Count 56
PubMed Score 267.23
PubTator Score 243.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
lung cancer -1.500 3.5e-03
acute myeloid leukemia 2.000 3.2e-03
adult high grade glioma 1.200 6.9e-03
Astrocytoma, Pilocytic 1.100 8.4e-04
Breast cancer -1.100 1.7e-03
breast carcinoma 1.100 1.4e-03
chronic lymphosyte leukemia -1.700 5.6e-06
colon cancer -1.700 3.2e-02
cutaneous lupus erythematosus 2.600 5.1e-04
diabetes mellitus -1.200 4.3e-02
glioblastoma 2.100 2.7e-04
group 3 medulloblastoma -1.300 2.2e-02
head and neck cancer and chronic obstruc... 1.100 2.0e-02
interstitial cystitis 1.700 4.3e-03
invasive ductal carcinoma 1.234 4.7e-05
lung carcinoma -2.800 2.2e-27
medulloblastoma, large-cell -2.800 1.2e-05
mucosa-associated lymphoid tissue lympho... 1.834 6.8e-03
osteosarcoma -1.883 1.8e-02
ovarian cancer -1.400 8.0e-04
primary Sjogren syndrome 1.800 4.2e-03
psoriasis 1.500 1.6e-03
Rheumatoid arthritis 2.200 3.0e-03
sarcoidosis 1.400 3.4e-02
subependymal giant cell astrocytoma 1.479 3.4e-02
tuberculosis 1.100 9.8e-06
ulcerative colitis 2.000 2.6e-06

Protein-protein Interaction (1)

Gene RIF (24)

AA Sequence

MAKYNTGGNPTEDVSVNSRPFRVTGPNSSSGIQARKNLFNNQGNASPPAGPSNVPKFGSPKPPVAVKPSS      1 - 70
EEKPDKEPKPPFLKPTGAGQRFGTPASLTTRDPEAKVGFLKPVGPKPINLPKEDSKPTFPWPPGNKPSLH     71 - 140
SVNQDHDLKPLGPKSGPTPPTSENEQKQAFPKLTGVKGKFMSASQDLEPKPLFPKPAFGQKPPLSTENSH    141 - 210
EDESPMKNVSSSKGSPAPLGVRSKSGPLKPAREDSENKDHAGEISSLPFPGVVLKPAASRGGPGLSKNGE    211 - 280
EKKEDRKIDAAKNTFQSKINQEELASGTPPARFPKAPSKLTVGGPWGQSQEKEKGDKNSATPKQKPLPPL    281 - 350
FTLGPPPPKPNRPPNVDLTKFHKTSSGNSTSKGQTSYSTTSLPPPPPSHPASQPPLPASHPSQPPVPSLP    351 - 420
PRNIKPPFDLKSPVNEDNQDGVTHSDGAGNLDEEQDSEGETYEDIEASKEREKKREKEEKKRLELEKKEQ    421 - 490
KEKEKKEQEIKKKFKLTGPIQVIHLAKACCDVKGGKNELSFKQGEQIEIIRITDNPEGKWLGRTARGSYG    491 - 560
YIKTTAVEIDYDSLKLKKDSLGAPSRPIEDDQEVYDDVAEQDDISSHSQSGSGGIFPPPPDDDIYDGIEE    561 - 630
EDADDGFPAPPKQLDMGDEVYDDVDTSDFPVSSAEMSQGTNVGKAKTEEKDLKKLKKQEKEEKDFRKKFK    631 - 700
YDGEIRVLYSTKVTTSITSKKWGTRDLQVKPGESLEVIQTTDDTKVLCRNEEGKYGYVLRSYLADNDGEI    701 - 770
YDDIADGCIYDND                                                             771 - 783
//

Text Mined References (64)

PMID Year Title