Property Summary

NCBI Gene PubMed Count 51
Grant Count 99
R01 Count 68
Funding $9,935,995.05
PubMed Score 258.90
PubTator Score 243.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
Rheumatoid Arthritis 2.200 0.003
cutaneous lupus erythematosus 2.600 0.001
psoriasis 1.500 0.002
glioblastoma 2.100 0.000
osteosarcoma -3.201 0.002
chronic lymphosyte leukemia -1.700 0.000
group 4 medulloblastoma -2.000 0.000
medulloblastoma, large-cell -2.800 0.000
tuberculosis 2.300 0.000
colon cancer -1.700 0.032
lung cancer -3.200 0.000
sarcoidosis 2.400 0.013
breast carcinoma 1.100 0.001
diabetes mellitus -1.200 0.043
interstitial cystitis 2.100 0.003
pediatric high grade glioma 1.300 0.002
pilocytic astrocytoma 1.900 0.000
primary Sjogren syndrome 1.800 0.004
subependymal giant cell astrocytoma 2.519 0.026
invasive ductal carcinoma 1.564 0.000
lung carcinoma -2.800 0.000
Breast cancer -1.100 0.002
mucosa-associated lymphoid tissue lympho... 1.834 0.007
acute myeloid leukemia 2.000 0.003
ulcerative colitis 2.000 0.000
ovarian cancer 2.200 0.000
head and neck cancer and chronic obstruc... 1.100 0.020

Synonym

Accession O15117 A8K2Y8 B4DLN2 E9PBV9 O00359 Q9NZI9
Symbols ADAP
PRO0823
SLAP130
SLAP-130

Gene

FYB

PDB

1RI9   2GTJ   2GTO  

Gene RIF (22)

PMID Text
26246585 A distinct set of proteins interaction partners required for chemokine-directed T cell migration is attracted by phosphotyrosine 571 of ADAP, including ZAP70.
26202465 Data strongly suggest that chemokine-stimulated associations between Vav1, SLP-76, and ADAP facilitate Rac1 activation and alpha4beta1-mediated adhesion, whereas Pyk2 opposes this adhesion by limiting Rac1 activation.
25909459 Data (including data from studies in knockout/transgenic mice) suggest that ADAP regulates positive feedback loop of TGFbeta1 production and TGFbeta1-induced CD103 expression in CD8+ T-lymphocytes and protects against influenza H5N1 virus infection.
25876182 FYB nonsense mutations in humans causing small-platelet thrombocytopenia and a significant bleeding tendency.
25729932 The aim of this study was to perform an association study between seven Fyn-binding protein gene (FYB)-tag single nucleotide polymorphisms (SNPs) and type I diabetes mellitus (T1DM), as well as with disease age of onset.
25516138 The autosomal recessive bleeding phenotype seen in several members of this highly consanguineous family included petechial rash, mild epistaxis and thrombocytopenia with some decrease in platelet volume. These clinical findings, together with the results of exome sequencing pointed to only one strong candidate gene, the FYB gene.
24769494 ADAP and Nck adapter proteins cooperatively facilitate T cell adhesion to the LFA-1 ligand ICAM-1.
24523237 ADAP interacts with talin and kindlin-3 to promote platelet Integrin alphaIIbbeta3 activation and stable fibrinogen binding.
24047317 These findings indicate that ADAP regulates two steps of HIV-1 infection cooperatively with two distinct receptors, and as such, serves as a new potential target in the blockade of HIV-1 infection.
23979596 Multipoint binding of SLP-76 to ADAP facilitates the assembly of SLP-76 microclusters.
More...

AA Sequence

MAKYNTGGNPTEDVSVNSRPFRVTGPNSSSGIQARKNLFNNQGNASPPAGPSNVPKFGSPKPPVAVKPSS      1 - 70
EEKPDKEPKPPFLKPTGAGQRFGTPASLTTRDPEAKVGFLKPVGPKPINLPKEDSKPTFPWPPGNKPSLH     71 - 140
SVNQDHDLKPLGPKSGPTPPTSENEQKQAFPKLTGVKGKFMSASQDLEPKPLFPKPAFGQKPPLSTENSH    141 - 210
EDESPMKNVSSSKGSPAPLGVRSKSGPLKPAREDSENKDHAGEISSLPFPGVVLKPAASRGGPGLSKNGE    211 - 280
EKKEDRKIDAAKNTFQSKINQEELASGTPPARFPKAPSKLTVGGPWGQSQEKEKGDKNSATPKQKPLPPL    281 - 350
FTLGPPPPKPNRPPNVDLTKFHKTSSGNSTSKGQTSYSTTSLPPPPPSHPASQPPLPASHPSQPPVPSLP    351 - 420
PRNIKPPFDLKSPVNEDNQDGVTHSDGAGNLDEEQDSEGETYEDIEASKEREKKREKEEKKRLELEKKEQ    421 - 490
KEKEKKEQEIKKKFKLTGPIQVIHLAKACCDVKGGKNELSFKQGEQIEIIRITDNPEGKWLGRTARGSYG    491 - 560
YIKTTAVEIDYDSLKLKKDSLGAPSRPIEDDQEVYDDVAEQDDISSHSQSGSGGIFPPPPDDDIYDGIEE    561 - 630
EDADDGFPAPPKQLDMGDEVYDDVDTSDFPVSSAEMSQGTNVGKAKTEEKDLKKLKKQEKEEKDFRKKFK    631 - 700
YDGEIRVLYSTKVTTSITSKKWGTRDLQVKPGESLEVIQTTDDTKVLCRNEEGKYGYVLRSYLADNDGEI    701 - 770
YDDIADGCIYDND                                                             771 - 783
//

Text Mined References (59)

PMID Year Title
26246585 2015 Analysis of Phosphorylation-dependent Protein Interactions of Adhesion and Degranulation Promoting Adaptor Protein (ADAP) Reveals Novel Interaction Partners Required for Chemokine-directed T cell Migration.
26202465 2015 Positive and negative regulation by SLP-76/ADAP and Pyk2 of chemokine-stimulated T-lymphocyte adhesion mediated by integrin ?4?1.
25909459 2015 The Immune Adaptor ADAP Regulates Reciprocal TGF-?1-Integrin Crosstalk to Protect from Influenza Virus Infection.
25876182 2015 Deleterious mutation in the FYB gene is associated with congenital autosomal recessive small-platelet thrombocytopenia.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25729932 2015 Short Communication FYB polymorphisms in Brazilian patients with type I diabetes mellitus and autoimmune polyglandular syndrome type III.
25516138 2014 Recessive thrombocytopenia likely due to a homozygous pathogenic variant in the FYB gene: case report.
24769494 2014 The adapter proteins ADAP and Nck cooperate in T cell adhesion.
24523237 2014 ADAP interactions with talin and kindlin promote platelet integrin ?IIb?3 activation and stable fibrinogen binding.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...