Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.14
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.433 0.002
juvenile dermatomyositis 1.003 0.000
ovarian cancer -1.700 0.000
dermatomyositis 1.500 0.001

Synonym

Accession O15063 Q2M3W4
Symbols

Gene

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MYCCSAQDSKMDYKRRFLLGGSKQKVQQHQQYPMPELGRALSAPLASTATTAPLGSLTAAGSCHHAMPHT      1 - 70
TPIADIQQGISKYLDALNVFCRASTFLTDLFSTVFRNSHYSKAATQLKDVQEHVMEAASRLTSAIKPEIA     71 - 140
KMLMELSAGAANFTDQKEFSLQDIEVLGRCFLTVVQVHFQFLTHALQKVQPVAHSCFAEVIVPEKKNSGS    141 - 210
GGGLSGMGHTPEVEEAVRSWRGAAEATSRLRERGCDGCLAGIEVQQLFCSQSAAIPEHQLKELNIKIDSA    211 - 280
LQAYKIALESLGHCEYAMKAGFHLNPKAIEASLQGCCSEAEAQQTGRRQTPPQPMQCELPTVPVQIGSHF    281 - 350
LKGVSFNESAADNLKLKTHTMLQLMKEAGCYNGITSRDDFPVTEVLNQVCPSTWRGACKTAVQLLFGQAG    351 - 420
LVVVDTAQIENKEAYAPQISLEGSRIVVQVPSTWCLKEDPATMSLLQRSLDPEKTLGLVDVLYTAVLDLN    421 - 490
RWRAGREQALPCIQIQLQREICDFGNQADLPSGNGNKSSGGLQKTFSKLTSRFTKKASCTSSSSSTNYSI    491 - 560
QNTPSKNIFIAGCSEEKAKMPGNIDTRLQSILNIGNFPRTTDPSQSAQNSSNTVANGFLMERRENFLHGD    561 - 630
DGKDEKGMNLPTDQEMQEVIDFLSGFNMGQSHQGSPLVTRHNSAATAMVTEQKAGAMQPQQPSLPVPPPP    631 - 700
RAPQAGAHTPLTPQPGLAPQQQSPKQQQPQVQYYQHLLQPIGPQQPPPQPRAPGKWVHGSSQQPAQAVGA    701 - 770
GLSPLGQWPGISDLSSDLYSLGLVSSYMDNVMSEVLGQKPQGPRNNTWPNRDQSDGVFGMLGEILPFDPA    771 - 840
VGSDPEFARYVAGVSQAMQQKRQAQHGRRPGNPRGNWPPMDDAHRTWPFPEFFTEGDGLHGGWSGAQGDS    841 - 910
ASSSDETSSANGDSLFSMFSGPDLVAAVKQRRKHSSGEQDTSTLPSPPLLTTVEDVNQDNKTKTWPPKAP    911 - 980
WQHPSPLPSTLPSPSAPLYAVTSPGSQWNDTMQMLQSPVWAATNDCSAAAFSYVQTPPQPPPPPAHKAAP    981 - 1050
KGFKAFPGKGERRPAYLPQY                                                     1051 - 1070
//

Text Mined References (9)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20215924 2010 A genome-wide association study of amygdala activation in youths with and without bipolar disorder.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11337467 2001 Identification and characterization of the potential promoter regions of 1031 kinds of human genes.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.