Property Summary

NCBI Gene PubMed Count 51
PubMed Score 144.66
PubTator Score 68.02

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 3.15984392201882E-13
osteosarcoma 7933 1.93046909291301E-7
psoriasis 6685 4.50594563446202E-6
malignant mesothelioma 3163 9.59863757251131E-6
primitive neuroectodermal tumor 3031 2.54786826806813E-5
glioblastoma 5572 4.82451986532392E-5
atypical teratoid / rhabdoid tumor 4369 7.62603244864401E-5
tuberculosis 1563 9.68245518273527E-5
lung cancer 4473 1.58077499590272E-4
medulloblastoma, large-cell 6234 2.8893539031588E-4
medulloblastoma 1524 9.29340580688526E-4
ependymoma 2514 0.00271729805750327
Disease Target Count Z-score Confidence
Cancer 2346 3.207 1.6


  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
ependymoma 1.100 0.003
psoriasis -3.900 0.000
osteosarcoma -1.981 0.000
medulloblastoma 1.500 0.001
atypical teratoid / rhabdoid tumor 1.300 0.000
glioblastoma 1.200 0.000
medulloblastoma, large-cell 1.700 0.000
primitive neuroectodermal tumor 1.500 0.000
tuberculosis -1.800 0.000
non-small cell lung cancer -1.583 0.000
lung cancer -2.000 0.000


Accession O15054 C9IZ40 Q96G33
Symbols JMJD3


PANTHER Protein Class (1)


2XUE   2XXZ   4ASK   5FP3  

  Ortholog (6)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Anole lizard OMA Inparanoid

 GO Component (2)

Gene RIF (46)

26871869 JMJD3 and EZH2 in prostate biopsies also demonstrated an increase of JMJD3 and EZH2 in adenocarcinoma with Gleason score 7 and 8 by comparison with a normal biopsy.
26802933 JMJD3 up-regulation and NF-kappaB activation occur in the region of the wound edge during keratinocyte wound healing
26795455 Jmjd3 regulates osteoblast apoptosis through targeting Bcl-2 expression and Bim phosphorylation.
26729791 Findings reveal a novel epigenetic mechanism by which JMJD3 promotes melanoma progression and metastasis.
26416711 Low JMJD3 expression is associated with Colorectal Cancer.
26303949 KDM6B may act in a pro-apoptotic role in NSCLC.
26261509 We demonstrate that KDM6B plays a key role in clear cell renal cell carcinoma
26193001 JMJD3 is an epigenetic regulator in development and disease. (Review)
25827480 Demethylation of IGFBP5 by Histone Demethylase KDM6B Promotes Mesenchymal Stem Cell-Mediated Periodontal Tissue Regeneration by Enhancing Osteogenic Differentiation and Anti-Inflammation Potentials.
25791244 Data indicate a reverse correlation between the mRNA levels of histone H3 lysine-27 demethylase (JMJD3) and global histone h3 lysine 27 methylation (H3K27me3).

AA Sequence

AGLQGVVVLEQYRTEELAQAYDAFTLAPASTSR                                        1611 - 1643

Text Mined References (57)

PMID Year Title
26871869 2016 The JMJD3 Histone Demethylase and the EZH2 Histone Methyltransferase in Prostate Cancer.
26802933 2016 Histone H3K27 Demethylase JMJD3 in Cooperation with NF-?B Regulates Keratinocyte Wound Healing.
26795455 2016 Histone demethylase Jmjd3 regulates osteoblast apoptosis through targeting anti-apoptotic protein Bcl-2 and pro-apoptotic protein Bim.
26729791 2016 H3K27 Demethylase JMJD3 Employs the NF-?B and BMP Signaling Pathways to Modulate the Tumor Microenvironment and Promote Melanoma Progression and Metastasis.
26416711 2016 The Prognostic Significance of Histone Lysine Demethylase JMJD3/KDM6B in Colorectal Cancer.
26303949 2015 KDM6B Elicits Cell Apoptosis by Promoting Nuclear Translocation of FOXO1 in Non-Small Cell Lung Cancer.
26261509 2015 KDM6B induces epithelial-mesenchymal transition and enhances clear cell renal cell carcinoma metastasis through the activation of SLUG.
26193001 2015 JMJD3 as an epigenetic regulator in development and disease.
25827480 2015 Demethylation of IGFBP5 by Histone Demethylase KDM6B Promotes Mesenchymal Stem Cell-Mediated Periodontal Tissue Regeneration by Enhancing Osteogenic Differentiation and Anti-Inflammation Potentials.
25791244 2015 Overexpression of JMJD3 may contribute to demethylation of H3K27me3 in CD4+ T cells from patients with systemic sclerosis.