Property Summary

NCBI Gene PubMed Count 51
Grant Count 81
R01 Count 48
Funding $8,742,079.84
PubMed Score 144.66
PubTator Score 68.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
ependymoma 1.100 0.003
psoriasis -3.900 0.000
osteosarcoma -1.981 0.000
medulloblastoma 1.500 0.001
atypical teratoid / rhabdoid tumor 1.300 0.000
glioblastoma 1.200 0.000
medulloblastoma, large-cell 1.700 0.000
primitive neuroectodermal tumor 1.500 0.000
tuberculosis -1.800 0.000
non-small cell lung cancer -1.583 0.000
lung cancer -2.000 0.000

Synonym

Accession O15054 C9IZ40 Q96G33
Symbols JMJD3

Gene

PANTHER Protein Class (1)

PDB

2XUE   2XXZ   4ASK   5FP3  

 GO Component (2)

Gene RIF (46)

PMID Text
26871869 JMJD3 and EZH2 in prostate biopsies also demonstrated an increase of JMJD3 and EZH2 in adenocarcinoma with Gleason score 7 and 8 by comparison with a normal biopsy.
26802933 JMJD3 up-regulation and NF-kappaB activation occur in the region of the wound edge during keratinocyte wound healing
26795455 Jmjd3 regulates osteoblast apoptosis through targeting Bcl-2 expression and Bim phosphorylation.
26729791 Findings reveal a novel epigenetic mechanism by which JMJD3 promotes melanoma progression and metastasis.
26416711 Low JMJD3 expression is associated with Colorectal Cancer.
26303949 KDM6B may act in a pro-apoptotic role in NSCLC.
26261509 We demonstrate that KDM6B plays a key role in clear cell renal cell carcinoma
26193001 JMJD3 is an epigenetic regulator in development and disease. (Review)
25827480 Demethylation of IGFBP5 by Histone Demethylase KDM6B Promotes Mesenchymal Stem Cell-Mediated Periodontal Tissue Regeneration by Enhancing Osteogenic Differentiation and Anti-Inflammation Potentials.
25791244 Data indicate a reverse correlation between the mRNA levels of histone H3 lysine-27 demethylase (JMJD3) and global histone h3 lysine 27 methylation (H3K27me3).
More...

AA Sequence

MHRAVDPPGARAAREAFALGGLSCAGAWSSCPPHPPPRSAWLPGGRCSASIGQPPLPAPLPPSHGSSSGH      1 - 70
PSKPYYAPGAPTPRPLHGKLESLHGCVQALLREPAQPGLWEQLGQLYESEHDSEEATRCYHSALRYGGSF     71 - 140
AELGPRIGRLQQAQLWNFHTGSCQHRAKVLPPLEQVWNLLHLEHKRNYGAKRGGPPVKRAAEPPVVQPVP    141 - 210
PAALSGPSGEEGLSPGGKRRRGCNSEQTGLPPGLPLPPPPLPPPPPPPPPPPPPLPGLATSPPFQLTKPG    211 - 280
LWSTLHGDAWGPERKGSAPPERQEQRHSLPHPYPYPAPAYTAHPPGHRLVPAAPPGPGPRPPGAESHGCL    281 - 350
PATRPPGSDLRESRVQRSRMDSSVSPAATTACVPYAPSRPPGLPGTTTSSSSSSSSNTGLRGVEPNPGIP    351 - 420
GADHYQTPALEVSHHGRLGPSAHSSRKPFLGAPAATPHLSLPPGPSSPPPPPCPRLLRPPPPPAWLKGPA    421 - 490
CRAAREDGEILEELFFGTEGPPRPAPPPLPHREGFLGPPASRFSVGTQDSHTPPTPPTPTTSSSNSNSGS    491 - 560
HSSSPAGPVSFPPPPYLARSIDPLPRPPSPAQNPQDPPLVPLTLALPPAPPSSCHQNTSGSFRRPESPRP    561 - 630
RVSFPKTPEVGPGPPPGPLSKAPQPVPPGVGELPARGPRLFDFPPTPLEDQFEEPAEFKILPDGLANIMK    631 - 700
MLDESIRKEEEQQQHEAGVAPQPPLKEPFASLQSPFPTDTAPTTTAPAVAVTTTTTTTTTTTATQEEEKK    701 - 770
PPPALPPPPPLAKFPPPSQPQPPPPPPPSPASLLKSLASVLEGQKYCYRGTGAAVSTRPGPLPTTQYSPG    771 - 840
PPSGATALPPTSAAPSAQGSPQPSASSSSQFSTSGGPWARERRAGEEPVPGPMTPTQPPPPLSLPPARSE    841 - 910
SEVLEEISRACETLVERVGRSATDPADPVDTAEPADSGTERLLPPAQAKEEAGGVAAVSGSCKRRQKEHQ    911 - 980
KEHRRHRRACKDSVGRRPREGRAKAKAKVPKEKSRRVLGNLDLQSEEIQGREKSRPDLGGASKAKPPTAP    981 - 1050
APPSAPAPSAQPTPPSASVPGKKAREEAPGPPGVSRADMLKLRSLSEGPPKELKIRLIKVESGDKETFIA   1051 - 1120
SEVEERRLRMADLTISHCAADVVRASRNAKVKGKFRESYLSPAQSVKPKINTEEKLPREKLNPPTPSIYL   1121 - 1190
ESKRDAFSPVLLQFCTDPRNPITVIRGLAGSLRLNLGLFSTKTLVEASGEHTVEVRTQVQQPSDENWDLT   1191 - 1260
GTRQIWPCESSRSHTTIAKYAQYQASSFQESLQEEKESEDEESEEPDSTTGTPPSSAPDPKNHHIIKFGT   1261 - 1330
NIDLSDAKRWKPQLQELLKLPAFMRVTSTGNMLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVN   1331 - 1400
INIGPGDCEWFAVHEHYWETISAFCDRHGVDYLTGSWWPILDDLYASNIPVYRFVQRPGDLVWINAGTVH   1401 - 1470
WVQATGWCNNIAWNVGPLTAYQYQLALERYEWNEVKNVKSIVPMIHVSWNVARTVKISDPDLFKMIKFCL   1471 - 1540
LQSMKHCQVQRESLVRAGKKIAYQGRVKDEPAYYCNECDVEVFNILFVTSENGSRNTYLVHCEGCARRRS   1541 - 1610
AGLQGVVVLEQYRTEELAQAYDAFTLAPASTSR                                        1611 - 1643
//

Text Mined References (57)

PMID Year Title
26871869 2016 The JMJD3 Histone Demethylase and the EZH2 Histone Methyltransferase in Prostate Cancer.
26802933 2016 Histone H3K27 Demethylase JMJD3 in Cooperation with NF-?B Regulates Keratinocyte Wound Healing.
26795455 2016 Histone demethylase Jmjd3 regulates osteoblast apoptosis through targeting anti-apoptotic protein Bcl-2 and pro-apoptotic protein Bim.
26729791 2016 H3K27 Demethylase JMJD3 Employs the NF-?B and BMP Signaling Pathways to Modulate the Tumor Microenvironment and Promote Melanoma Progression and Metastasis.
26416711 2016 The Prognostic Significance of Histone Lysine Demethylase JMJD3/KDM6B in Colorectal Cancer.
26303949 2015 KDM6B Elicits Cell Apoptosis by Promoting Nuclear Translocation of FOXO1 in Non-Small Cell Lung Cancer.
26261509 2015 KDM6B induces epithelial-mesenchymal transition and enhances clear cell renal cell carcinoma metastasis through the activation of SLUG.
26193001 2015 JMJD3 as an epigenetic regulator in development and disease.
25827480 2015 Demethylation of IGFBP5 by Histone Demethylase KDM6B Promotes Mesenchymal Stem Cell-Mediated Periodontal Tissue Regeneration by Enhancing Osteogenic Differentiation and Anti-Inflammation Potentials.
25791244 2015 Overexpression of JMJD3 may contribute to demethylation of H3K27me3 in CD4+ T cells from patients with systemic sclerosis.
More...