Property Summary

NCBI Gene PubMed Count 38
Grant Count 116
R01 Count 80
Funding $14,977,959.69
PubMed Score 346.28
PubTator Score 238.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.400 0.000
osteosarcoma -2.424 0.000

Synonym

Accession O15047 A6NP62 Q6PIF3 Q8TAJ6
Symbols Set1
KMT2F
Set1A

Gene

PDB

3S8S   3UVN   4EWR  

Gene RIF (23)

PMID Text
26974950 Loss-of-function variants in SETD1A cause a range of neurodevelopmental disorders in a Finnish population.
26938441 This study demonstrated that SETD1A mutation showing the highest statistical significance in Autism and Schizophrenia.
26691508 Set1 role in cellular reprogramming and its interactions with Dpy30,Myc,Sox2 and Ash2l reprogramming factors
26581161 Findings provide evidence that SET1A cooperates with CUDR to play a positive potential role during hepatocarcinogenesis and hepatocyte-like stem cells' malignant transformation epigenetically.
26478434 Set1/MLL complex is indispensable for the transcriptional ability of HSF2.
26394836 suppresses BTG2 expression through its induction of several BTG2-targeting miRNAs
26015494 results demonstrate a novel function of BAF as an epigenetic regulator of HSV lytic infection; hypothesize that BAF facilitates Herpes Simplex Virus IE and E gene expression by recruiting the SETD1A methyltransferase to viral IE and E gene promoters
25561738 these results form the basis for understanding how WRAD(DRY-30) differentially regulates SET1 family complexes in vivo.
25542209 Based on our structural data and cross-linking results, we suggest that Dpy30 may regulate H3K4 methylation according to its copy number in COMPASS
25373480 Study reveals that SETD1A controls tumor metastasis by activating matrix metalloproteinases (MMP) expression and provides an epigenetic link among SETD1A, MMPs, and metastasis of breast cancer.
More...

AA Sequence

MDQEGGGDGQKAPSFQWRNYKLIVDPALDPALRRPSQKVYRYDGVHFSVNDSKYIPVEDLQDPRCHVRSK      1 - 70
NRDFSLPVPKFKLDEFYIGQIPLKEVTFARLNDNVRETFLKDMCRKYGEVEEVEILLHPRTRKHLGLARV     71 - 140
LFTSTRGAKETVKNLHLTSVMGNIIHAQLDIKGQQRMKYYELIVNGSYTPQTVPTGGKALSEKFQGSGAA    141 - 210
TETAESRRRSSSDTAAYPAGTTAVGTPGNGTPCSQDTSFSSSRQDTPSSFGQFTPQSSQGTPYTSRGSTP    211 - 280
YSQDSAYSSSTTSTSFKPRRSENSYQDAFSRRHFSASSASTTASTAIAATTAATASSSASSSSLSSSSSS    281 - 350
SSSSSSSQFRSSDANYPAYYESWNRYQRHTSYPPRRATREEPPGAPFAENTAERFPPSYTSYLPPEPSRP    351 - 420
TDQDYRPPASEAPPPEPPEPGGGGGGGGPSPEREEVRTSPRPASPARSGSPAPETTNESVPFAQHSSLDS    421 - 490
RIEMLLKEQRSKFSFLASDTEEEEENSSMVLGARDTGSEVPSGSGHGPCTPPPAPANFEDVAPTGSGEPG    491 - 560
ATRESPKANGQNQASPCSSGDDMEISDDDRGGSPPPAPTPPQQPPPPPPPPPPPPPYLASLPLGYPPHQP    561 - 630
AYLLPPRPDGPPPPEYPPPPPPPPHIYDFVNSLELMDRLGAQWGGMPMSFQMQTQMLTRLHQLRQGKGLI    631 - 700
AASAGPPGGAFGEAFLPFPPPQEAAYGLPYALYAQGQEGRGAYSREAYHLPMPMAAEPLPSSSVSGEEAR    701 - 770
LPPREEAELAEGKTLPTAGTVGRVLAMLVQEMKSIMQRDLNRKMVENVAFGAFDQWWESKEEKAKPFQNA    771 - 840
AKQQAKEEDKEKTKLKEPGLLSLVDWAKSGGTTGIEAFAFGSGLRGALRLPSFKVKRKEPSEISEASEEK    841 - 910
RPRPSTPAEEDEDDPEQEKEAGEPGRPGTKPPKRDEERGKTQGKHRKSFALDSEGEEASQESSSEKDEED    911 - 980
DEEDEEDEDREEAVDTTKKETEVSDGEDEESDSSSKCSLYADSDGENDSTSDSESSSSSSSSSSSSSSSS    981 - 1050
SSSSSSSSESSSEDEEEEERPAALPSASPPPREVPVPTPAPVEVPVPERVAGSPVTPLPEQEASPARPAG   1051 - 1120
PTEESPPSAPLRPPEPPAGPPAPAPRPDERPSSPIPLLPPPKKRRKTVSFSAIEVVPAPEPPPATPPQAK   1121 - 1190
FPGPASRKAPRGVERTIRNLPLDHASLVKSWPEEVSRGGRSRAGGRGRLTEEEEAEPGTEVDLAVLADLA   1191 - 1260
LTPARRGLPALPAVEDSEATETSDEAERPRPLLSHILLEHNYALAVKPTPPAPALRPPEPVPAPAALFSS   1261 - 1330
PADEVLEAPEVVVAEAEEPKPQQLQQQREEGEEEGEEEGEEEEEESSDSSSSSDGEGALRRRSLRSHARR   1331 - 1400
RRPPPPPPPPPPRAYEPRSEFEQMTILYDIWNSGLDSEDMSYLRLTYERLLQQTSGADWLNDTHWVHHTI   1401 - 1470
TNLTTPKRKRRPQDGPREHQTGSARSEGYYPISKKEKDKYLDVCPVSARQLEGVDTQGTNRVLSERRSEQ   1471 - 1540
RRLLSAIGTSAIMDSDLLKLNQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQNIRQMVADMR   1541 - 1610
EKRYVQEGIGSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSKQPIGVDEEI   1611 - 1680
TYDYKFPLEDNKIPCLCGTESCRGSLN                                              1681 - 1707
//

Text Mined References (47)

PMID Year Title
27141965 2016 Setd1a and NURF mediate chromatin dynamics and gene regulation during erythroid lineage commitment and differentiation.
26974950 2016 Rare loss-of-function variants in SETD1A are associated with schizophrenia and developmental disorders.
26938441 2016 De Novo Synonymous Mutations in Regulatory Elements Contribute to the Genetic Etiology of Autism and Schizophrenia.
26691508 2015 Physical Interactions and Functional Coordination between the Core Subunits of Set1/Mll Complexes and the Reprogramming Factors.
26581161 2016 SET1A Cooperates With CUDR to Promote Liver Cancer Growth and Hepatocyte-like Stem Cell Malignant Transformation Epigenetically.
26478434 2015 Set1/MLL complex is indispensable for the transcriptional ability of heat shock transcription factor 2.
26394836 2015 SETD1A modulates cell cycle progression through a miRNA network that regulates p53 target genes.
26015494 2015 Barrier-to-Autointegration Factor 1 (BAF/BANF1) Promotes Association of the SETD1A Histone Methyltransferase with Herpes Simplex Virus Immediate-Early Gene Promoters.
25561738 2015 Biochemical reconstitution and phylogenetic comparison of human SET1 family core complexes involved in histone methylation.
25542209 2015 Structural implications of Dpy30 oligomerization for MLL/SET1 COMPASS H3K4 trimethylation.
More...