Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.20
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
acute quadriplegic myopathy 1.312 2.2e-05
astrocytoma 1.200 1.3e-02
esophageal adenocarcinoma 1.300 4.8e-02
glioblastoma 1.200 2.6e-02
group 3 medulloblastoma 1.100 1.3e-02
juvenile dermatomyositis 1.189 5.7e-10
lung adenocarcinoma 1.059 3.6e-05
lung cancer 1.100 6.2e-03
malignant mesothelioma 1.400 1.8e-05
Multiple myeloma 1.417 7.6e-03
nasopharyngeal carcinoma 1.200 1.9e-04
non-small cell lung cancer 1.131 5.6e-19
osteosarcoma -1.410 3.2e-03
ovarian cancer -1.300 2.0e-04
pancreatic ductal adenocarcinoma liver m... 1.704 1.1e-02
Pick disease -1.100 8.3e-04
progressive supranuclear palsy -1.600 5.9e-03
psoriasis -1.100 8.2e-07
Waldenstrons macroglobulinemia 1.026 1.4e-02

Gene RIF (1)

AA Sequence

MADKTPGGSQKASSKTRSSDVHSSGSSDAHMDASGPSDSDMPSRTRPKSPRKHNYRNESARESLCDSPHQ      1 - 70
NLSRPLLENKLKAFSIGKMSTAKRTLSKKEQEELKKKEDEKAAAEIYEEFLAAFEGSDGNKVKTFVRGGV     71 - 140
VNAAKEEHETDEKRGKIYKPSSRFADQKNPPNQSSNERPPSLLVIETKKPPLKKGEKEKKKSNLELFKEE    141 - 210
LKQIQEERDERHKTKGRLSRFEPPQSDSDGQRRSMDAPSRRNRSSGVLDDYAPGSHDVGDPSTTNLYLGN    211 - 280
INPQMNEEMLCQEFGRFGPLASVKIMWPRTDEERARERNCGFVAFMNRRDAERALKNLNGKMIMSFEMKL    281 - 350
GWGKAVPIPPHPIYIPPSMMEHTLPPPPSGLPFNAQPRERLKNPNAPMLPPPKNKEDFEKTLSQAIVKVV    351 - 420
IPTERNLLALIHRMIEFVVREGPMFEAMIMNREINNPMFRFLFENQTPAHVYYRWKLYSILQGDSPTKWR    421 - 490
TEDFRMFKNGSFWRPPPLNPYLHGMSEEQETEAFVEEPSKKGALKEEQRDKLEEILRGLTPRKNDIGDAM    491 - 560
VFCLNNAEAAEEIVDCITESLSILKTPLPKKIARLYLVSDVLYNSSAKVANASYYRKFFETKLCQIFSDL    561 - 630
NATYRTIQGHLQSENFKQRVMTCFRAWEDWAIYPEPFLIKLQNIFLGLVNIIEEKETEDVPDDLDGAPIE    631 - 700
EELDGAPLEDVDGIPIDATPIDDLDGVPIKSLDDDLDGVPLDATEDSKKNEPIFKVAPSKWEAVDESELE    701 - 770
AQAVTTSKWELFDQHEESEEEENQNQEEESEDEEDTQSSKSEEHHLYSNPIKEEMTESKFSKYSEMSEEK    771 - 840
RAKLREIELKVMKFQDELESGKRPKKPGQSFQEQVEHYRDKLLQREKEKELERERERDKKDKEKLESRSK    841 - 910
DKKEKDECTPTRKERKRRHSTSPSPSRSSSGRRVKSPSPKSERSERSERSHKESSRSRSSHKDSPRDVSK    911 - 980
KAKRSPSGSRTPKRSRRSRSRSPKKSGKKSRSQSRSPHRSHKKSKKNKH                         981 - 1029
//

Text Mined References (23)

PMID Year Title