Property Summary

NCBI Gene PubMed Count 32
Grant Count 29
R01 Count 23
Funding $2,150,592.93
PubMed Score 40.32
PubTator Score 23.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
astrocytic glioma -1.400 0.006
ependymoma -1.600 0.000
oligodendroglioma -1.300 0.016
psoriasis -2.600 0.000
sonic hedgehog group medulloblastoma -1.900 0.000
medulloblastoma, large-cell -2.200 0.001
colon cancer -1.400 0.000
lung cancer -1.100 0.003
interstitial cystitis -2.700 0.000
lung adenocarcinoma -2.100 0.000
adult high grade glioma -1.400 0.031
pilocytic astrocytoma 3.200 0.000
inflammatory breast cancer -1.500 0.001
non-small cell lung carcinoma -1.200 0.000

Gene RIF (23)

PMID Text
26292963 Findings suggest that Plexin-D1/class III semaphorin (Sema3E) axis is triggered in systemic sclerosis (SSc) endothelium.
26086095 Infantile hemangioma-derived stem cells and endothelial cells are inhibited by SEMA3E and SEMA3F.
26036259 Authors suggest that silencing of Sema3E contributes to the pathogenesis of gastric cancer.
25985275 these results identify SEMA3E as an essential gene for GnRH neuron development, uncover a neurotrophic function for SEMA3E in the developing brain
25687026 The ANGPTL4 may be a candidate target in DME treatment and a biomarker of ischemic-induced retinopathy, including diabetic retinopathy.
24841563 The identification and characterization of SH3BP1 as a novel downstream effector of Sema3E-PlexinD1 provides an explanation for how extracellular signals are translated into cytoskeletal changes and unique cell behavior.
24825896 Semaphorin 3d requires neuropilin 1 or PI3K/Akt, whereas semaphorin 3e requires plexin D1 in directing endothelial motility.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of sema domain, immunoglobulin domain, short basic domain, secreted, 3E (SEMA3E) in primary human brain microvascular endothelial cells
24139859 A critical role of Sema3E/Plexin D1 interaction in tumor resistance to apoptosis.
23932461 Semaphorin 3E inhibits human airway smooth muscle cell proliferation and migration.
More...

AA Sequence

MASAGHIITLLLWGYLLELWTGGHTADTTHPRLRLSHKELLNLNRTSIFHSPFGFLDLHTMLLDEYQERL      1 - 70
FVGGRDLVYSLSLERISDGYKEIHWPSTALKMEECIMKGKDAGECANYVRVLHHYNRTHLLTCGTGAFDP     71 - 140
VCAFIRVGYHLEDPLFHLESPRSERGRGRCPFDPSSSFISTLIGSELFAGLYSDYWSRDAAIFRSMGRLA    141 - 210
HIRTEHDDERLLKEPKFVGSYMIPDNEDRDDNKVYFFFTEKALEAENNAHAIYTRVGRLCVNDVGGQRIL    211 - 280
VNKWSTFLKARLVCSVPGMNGIDTYFDELEDVFLLPTRDHKNPVIFGLFNTTSNIFRGHAICVYHMSSIR    281 - 350
AAFNGPYAHKEGPEYHWSVYEGKVPYPRPGSCASKVNGGRYGTTKDYPDDAIRFARSHPLMYQAIKPAHK    351 - 420
KPILVKTDGKYNLKQIAVDRVEAEDGQYDVLFIGTDNGIVLKVITIYNQEMESMEEVILEELQIFKDPVP    421 - 490
IISMEISSKRQQLYIGSASAVAQVRFHHCDMYGSACADCCLARDPYCAWDGISCSRYYPTGTHAKRRFRR    491 - 560
QDVRHGNAAQQCFGQQFVGDALDKTEEHLAYGIENNSTLLECTPRSLQAKVIWFVQKGRETRKEEVKTDD    561 - 630
RVVKMDLGLLFLRLHKSDAGTYFCQTVEHSFVHTVRKITLEVVEEEKVEDMFNKDDEEDRHHRMPCPAQS    631 - 700
SISQGAKPWYKEFLQLIGYSNFQRVEEYCEKVWCTDRKRKKLKMSPSKWKYANPQEKKLRSKPEHYRLPR    701 - 770
HTLDS                                                                     771 - 775
//

Text Mined References (33)

PMID Year Title
26292963 2015 Plexin-D1/Semaphorin 3E pathway may contribute to dysregulation of vascular tone control and defective angiogenesis in systemic sclerosis.
26086095 2015 Infantile hemangioma-derived stem cells and endothelial cells are inhibited by class 3 semaphorins.
26036259 2015 Epigenetically downregulated Semaphorin 3E contributes to gastric cancer.
25985275 2015 Dysfunctional SEMA3E signaling underlies gonadotropin-releasing hormone neuron deficiency in Kallmann syndrome.
25687026 2015 Aqueous Levels of Angiopoietin-like 4 and Semaphorin 3E Correlate with Nonperfusion Area and Macular Volume in Diabetic Retinopathy.
25134534 2014 Genome-wide association study identifies new susceptibility loci for epithelial ovarian cancer in Han Chinese women.
24841563 2014 An image-based RNAi screen identifies SH3BP1 as a key effector of Semaphorin 3E-PlexinD1 signaling.
24825896 2014 Semaphorin 3d and semaphorin 3e direct endothelial motility through distinct molecular signaling pathways.
24139859 2013 Semaphorin 3E suppresses tumor cell death triggered by the plexin D1 dependence receptor in metastatic breast cancers.
23932461 2014 Neuronal chemorepellent Semaphorin 3E inhibits human airway smooth muscle cell proliferation and migration.
More...