Property Summary

NCBI Gene PubMed Count 9
PubMed Score 9.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -2.800 8.0e-04
Alzheimer's disease 1.200 2.8e-02
astrocytic glioma -2.900 2.3e-03
Astrocytoma, Pilocytic -2.600 1.8e-05
atypical teratoid / rhabdoid tumor -3.200 2.0e-05
colon cancer 2.600 2.0e-02
ependymoma -3.200 8.6e-04
glioblastoma -2.900 6.0e-07
group 3 medulloblastoma -3.100 1.3e-02
lung cancer 2.200 3.9e-03
lung carcinoma 3.200 6.1e-53
medulloblastoma, large-cell -2.400 1.3e-02
oligodendroglioma -2.600 3.8e-03
Pick disease -1.700 6.2e-03
pituitary cancer -2.000 1.6e-06
progressive supranuclear palsy 1.500 3.5e-02

Gene RIF (2)

AA Sequence

MREAAERRQQLQLEHDQALAVLSAKQQEIDLLQKSKVRELEEKCRTQSEQFNLLSRDLEKFRQHAGKIDL      1 - 70
LGGSAVAPLDISTAPSKPFPQFMNGLATSLGKGQESAIGGSSAIGEYIRPLPQPGDRPEPLSAKPTFLSR     71 - 140
SGSARCRSESDMENERNSNTSKQRYSGKVHLCVARYSYNPFDGPNENPEAELPLTAGKYLYVYGDMDEDG    141 - 210
FYEGELLDGQRGLVPSNFVDFVQDNESRLASTLGNEQDQNFINHSGIGLEGEHILDLHSPTHIDAGITDN    211 - 280
SAGTLDVNIDDIGEDIVPYPRKITLIKQLAKSVIVGWEPPAVPPGWGTVSSYNVLVDKETRMNLTLGSRT    281 - 350
KALIEKLNMAACTYRISVQCVTSRGSSDELQCTLLVGKDVVVAPSHLRVDNITQISAQLSWLPTNSNYSH    351 - 420
VIFLNEEEFDIVKAARYKYQFFNLRPNMAYKVKVLAKPHQMPWQLPLEQREKKEAFVEFSTLPAGPPAPP    421 - 490
QDVTVQAGVTPATIRVSWRPPVLTPTGLSNGANVTGYGVYAKGQRVAEVIFPTADSTAVELVRLRSLEAK    491 - 560
GVTVRTLSAQGESVDSAVAAVPPELLVPPTPHPRPAPQSKPLASSGVPETKDEHLGPHARMDEAWEQSRA    561 - 630
PGPVHGHMLEPPVGPGRRSPSPSRILPQPQGTPVSTTVAKAMAREAAQRVAESSRLEKRSVFLERSSAGQ    631 - 700
YAASDEEDAYDSPDFKRRGASVDDFLKGSELGKQPHCCHGDEYHTESSRGSDLSDIMEEDEEELYSEMQL    701 - 770
EDGGRRRPSGTSHNALKILGNPASAGRVDHMGRRFPRGSAGPQRSRPVTVPSIDDYGRDRLSPDFYEESE    771 - 840
TDPGAEELPARIFVALFDYDPLTMSPNPDAAEEELPFKEGQIIKVYGDKDADGFYRGETCARLGLIPCNM    841 - 910
VSEIQADDEEMMDQLLRQGFLPLNTPVEKIERSRRSGRRHSVSTRRMVALYDYDPRESSPNVDVEAELTF    911 - 980
CTGDIITVFGEIDEDGFYYGELNGQKGLVPSNFLEEVPDDVEVYLSDAPSHYSQDTPMRSKAKRKKSVHF    981 - 1050
TP                                                                       1051 - 1052
//

Text Mined References (11)

PMID Year Title