Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -2.900 0.002
ependymoma -3.200 0.001
oligodendroglioma -2.800 0.000
glioblastoma -3.700 0.000
sonic hedgehog group medulloblastoma -4.000 0.000
atypical teratoid / rhabdoid tumor -3.200 0.000
medulloblastoma, large-cell -2.400 0.013
colon cancer 2.600 0.020
lung cancer 3.800 0.000
pediatric high grade glioma -3.200 0.000
pilocytic astrocytoma -2.600 0.000
lung carcinoma 3.200 0.000
Alzheimer's disease 1.200 0.028
Pick disease -1.700 0.006
progressive supranuclear palsy 1.500 0.035
pituitary cancer -2.000 0.000

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17855024 RIMBP2 is identified in humans

AA Sequence

MREAAERRQQLQLEHDQALAVLSAKQQEIDLLQKSKVRELEEKCRTQSEQFNLLSRDLEKFRQHAGKIDL      1 - 70
LGGSAVAPLDISTAPSKPFPQFMNGLATSLGKGQESAIGGSSAIGEYIRPLPQPGDRPEPLSAKPTFLSR     71 - 140
SGSARCRSESDMENERNSNTSKQRYSGKVHLCVARYSYNPFDGPNENPEAELPLTAGKYLYVYGDMDEDG    141 - 210
FYEGELLDGQRGLVPSNFVDFVQDNESRLASTLGNEQDQNFINHSGIGLEGEHILDLHSPTHIDAGITDN    211 - 280
SAGTLDVNIDDIGEDIVPYPRKITLIKQLAKSVIVGWEPPAVPPGWGTVSSYNVLVDKETRMNLTLGSRT    281 - 350
KALIEKLNMAACTYRISVQCVTSRGSSDELQCTLLVGKDVVVAPSHLRVDNITQISAQLSWLPTNSNYSH    351 - 420
VIFLNEEEFDIVKAARYKYQFFNLRPNMAYKVKVLAKPHQMPWQLPLEQREKKEAFVEFSTLPAGPPAPP    421 - 490
QDVTVQAGVTPATIRVSWRPPVLTPTGLSNGANVTGYGVYAKGQRVAEVIFPTADSTAVELVRLRSLEAK    491 - 560
GVTVRTLSAQGESVDSAVAAVPPELLVPPTPHPRPAPQSKPLASSGVPETKDEHLGPHARMDEAWEQSRA    561 - 630
PGPVHGHMLEPPVGPGRRSPSPSRILPQPQGTPVSTTVAKAMAREAAQRVAESSRLEKRSVFLERSSAGQ    631 - 700
YAASDEEDAYDSPDFKRRGASVDDFLKGSELGKQPHCCHGDEYHTESSRGSDLSDIMEEDEEELYSEMQL    701 - 770
EDGGRRRPSGTSHNALKILGNPASAGRVDHMGRRFPRGSAGPQRSRPVTVPSIDDYGRDRLSPDFYEESE    771 - 840
TDPGAEELPARIFVALFDYDPLTMSPNPDAAEEELPFKEGQIIKVYGDKDADGFYRGETCARLGLIPCNM    841 - 910
VSEIQADDEEMMDQLLRQGFLPLNTPVEKIERSRRSGRRHSVSTRRMVALYDYDPRESSPNVDVEAELTF    911 - 980
CTGDIITVFGEIDEDGFYYGELNGQKGLVPSNFLEEVPDDVEVYLSDAPSHYSQDTPMRSKAKRKKSVHF    981 - 1050
TP                                                                       1051 - 1052
//

Text Mined References (11)

PMID Year Title
22005930 2012 Genome-wide association study of Alzheimer's disease with psychotic symptoms.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17855024 2007 Structure and evolution of RIM-BP genes: identification of a novel family member.
16541075 2006 The finished DNA sequence of human chromosome 12.
16112646 2005 Humoral detection of leukaemia-associated antigens in presentation acute myeloid leukaemia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10748113 2000 The RIM/NIM family of neuronal C2 domain proteins. Interactions with Rab3 and a new class of Src homology 3 domain proteins.
More...