Property Summary

NCBI Gene PubMed Count 28
PubMed Score 17.43
PubTator Score 40.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
acute quadriplegic myopathy 1.122 3.2e-06
astrocytic glioma 1.200 2.6e-03
atypical teratoid / rhabdoid tumor 1.300 3.1e-04
autosomal dominant Emery-Dreifuss muscul... 1.062 1.6e-03
chronic lymphosyte leukemia -1.200 1.9e-08
diabetes mellitus -1.100 1.1e-02
Duchenne muscular dystrophy 1.243 4.6e-09
ependymoma 2.300 2.4e-03
glioblastoma 1.100 1.1e-02
group 3 medulloblastoma 1.100 2.8e-02
juvenile dermatomyositis 1.296 1.3e-10
oligodendroglioma 1.600 1.1e-03
osteosarcoma 1.612 1.0e-03
ovarian cancer -1.900 1.4e-08
pancreatic cancer 1.100 4.2e-03
primary pancreatic ductal adenocarcinoma 1.158 4.8e-03
primitive neuroectodermal tumor 1.400 9.6e-03
psoriasis 2.700 1.9e-05

Pathway (1)

Gene RIF (11)

AA Sequence

MALQLWALTLLGLLGAGASLRPRKLDFFRSEKELNHLAVDEASGVVYLGAVNALYQLDAKLQLEQQVATG      1 - 70
PALDNKKCTPPIEASQCHEAEMTDNVNQLLLLDPPRKRLVECGSLFKGICALRALSNISLRLFYEDGSGE     71 - 140
KSFVASNDEGVATVGLVSSTGPGGDRVLFVGKGNGPHDNGIIVSTRLLDRTDSREAFEAYTDHATYKAGY    141 - 210
LSTNTQQFVAAFEDGPYVFFVFNQQDKHPARNRTLLARMCREDPNYYSYLEMDLQCRDPDIHAAAFGTCL    211 - 280
AASVAAPGSGRVLYAVFSRDSRSSGGPGAGLCLFPLDKVHAKMEANRNACYTGTREARDIFYKPFHGDIQ    281 - 350
CGGHAPGSSKSFPCGSEHLPYPLGSRDGLRGTAVLQRGGLNLTAVTVAAENNHTVAFLGTSDGRILKVYL    351 - 420
TPDGTSSEYDSILVEINKRVKRDLVLSGDLGSLYAMTQDKVFRLPVQECLSYPTCTQCRDSQDPYCGWCV    421 - 490
VEGRCTRKAECPRAEEASHWLWSRSKSCVAVTSAQPQNMSRRAQGEVQLTVSPLPALSEEDELLCLFGES    491 - 560
PPHPARVEGEAVICNSPSSIPVTPPGQDHVAVTIQLLLRRGNIFLTSYQYPFYDCRQAMSLEENLPCISC    561 - 630
VSNRWTCQWDLRYHECREASPNPEDGIVRAHMEDSCPQFLGPSPLVIPMNHETDVNFQGKNLDTVKGSSL    631 - 700
HVGSDLLKFMEPVTMQESGTFAFRTPKLSHDANETLPLHLYVKSYGKNIDSKLHVTLYNCSFGRSDCSLC    701 - 770
RAANPDYRCAWCGGQSRCVYEALCNTTSECPPPVITRIQPETGPLGGGIRITILGSNLGVQAGDIQRISV    771 - 840
AGRNCSFQPERYSVSTRIVCVIEAAETPFTGGVEVDVFGKLGRSPPNVQFTFQQPKPLSVEPQQGPQAGG    841 - 910
TTLTIHGTHLDTGSQEDVRVTLNGVPCKVTKFGAQLQCVTGPQATRGQMLLEVSYGGSPVPNPGIFFTYR    911 - 980
ENPVLRAFEPLRSFASGGRSINVTGQGFSLIQRFAMVVIAEPLQSWQPPREAESLQPMTVVGTDYVFHND    981 - 1050
TKVVFLSPAVPEEPEAYNLTVLIEMDGHRALLRTEAGAFEYVPDPTFENFTGGVKKQVNKLIHARGTNLN   1051 - 1120
KAMTLQEAEAFVGAERCTMKTLTETDLYCEPPEVQPPPKRRQKRDTTHNLPEFIVKFGSREWVLGRVEYD   1121 - 1190
TRVSDVPLSLILPLVIVPMVVVIAVSVYCYWRKSQQAEREYEKIKSQLEGLEESVRDRCKKEFTDLMIEM   1191 - 1260
EDQTNDVHEAGIPVLDYKTYTDRVFFLPSKDGDKDVMITGKLDIPEPRRPVVEQALYQFSNLLNSKSFLI   1261 - 1330
NFIHTLENQREFSARAKVYFASLLTVALHGKLEYYTDIMHTLFLELLEQYVVAKNPKLMLRRSETVVERM   1331 - 1400
LSNWMSICLYQYLKDSAGEPLYKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQ   1401 - 1470
DEGVDAIPVKVLNCDTISQVKEKIIDQVYRGQPCSCWPRPDSVVLEWRPGSTAQILSDLDLTSQREGRWK   1471 - 1540
RVNTLMHYNVRDGATLILSKVGVSQQPEDSQQDLPGERHALLEEENRVWHLVRPTDEVDEGKSKRGSVKE   1541 - 1610
KERTKAITEIYLTRLLSVKGTLQQFVDNFFQSVLAPGHAVPPAVKYFFDFLDEQAEKHNIQDEDTIHIWK   1611 - 1680
TNSLPLRFWVNILKNPHFIFDVHVHEVVDASLSVIAQTFMDACTRTEHKLSRDSPSNKLLYAKEISTYKK   1681 - 1750
MVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQYTQKYYDEIINALEEDPAAQKMQL   1751 - 1820
AFRLQQIAAALENKVTDL                                                       1821 - 1838
//

Text Mined References (32)

PMID Year Title