Property Summary

NCBI Gene PubMed Count 25
PubMed Score 13.39
PubTator Score 40.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
glioblastoma multiforme 347 3.72530536623796E-24
juvenile dermatomyositis 1189 1.26534839728088E-10
Duchenne muscular dystrophy 602 4.61774853392527E-9
chronic lymphosyte leukemia 232 1.92845081334623E-8
ovarian cancer 8492 1.79710012944378E-6
acute quadriplegic myopathy 1157 3.24755001380267E-6
psoriasis 6685 1.88718874868417E-5
medulloblastoma 1524 5.93815084494963E-5
atypical teratoid / rhabdoid tumor 4369 3.05209387584433E-4
osteosarcoma 7933 0.00103694039350393
oligodendroglioma 2849 0.00114139887131395
astrocytoma 1493 0.00126456660983557
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00160388800850623
ependymoma 2514 0.00236167438711716
pancreatic cancer 2300 0.00417760481815465
primary pancreatic ductal adenocarcinoma 1271 0.00481382905950592
primitive neuroectodermal tumor 3031 0.00963886801384292
diabetes mellitus 1663 0.0114436355448944
Disease Target Count Z-score Confidence
Situs Inversus 52 3.099 1.5

Expression

  Differential Expression (18)

Synonym

Accession O15031 A6QRH0 Q7KZU3 Q9BSU7
Symbols MM1
PLEXB2
Nbla00445
dJ402G11.3

Gene

PDB

4E71  

  Ortholog (10)

Species Source
Macaque OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid

Gene RIF (8)

PMID Text
26627240 Two related guanine nucleotide exchange factors (GEFs), PDZ-RhoGEF and leukemia-associated RhoGEF (LARG), use their PDZ domains to bind class B plexins and play critical roles in signaling.
26275342 Blocking of CD100, plexin B1 and/or B2 in adhesion experiments have shown that both CD100 and plexins act as adhesion molecules involved in monocyte-endothelial cell binding.
26035216 Results show that decreased expression of Sema4D, plexin-B1 and -B2 was associated with local recurrence and poor prognosis of breast neoplasm.
25762646 Plexin-B2 promotes glioma invasion and vascularization
25237006 In endometrial luminal epithelium, cadherin 6, desmoglein 2 and plexin b2 were surprisingly found in the apical as well as the lateral membrane domain; their knock-down compromised epithelial integrity.
24158112 High PLEXIN B2 expression is associated with high-grade gliomas.
12533544 cleavage by proprotein convertases is a novel regulatory step for semaphorin receptors localized at the cell surface.
12183458 Plexin B2 associates directly with two members of a recently identified family of Dbl homology/pleckstrin homology containing guanine nucleotide exchange factors for Rho, PDZ-RhoGEF, and Leukemia-associated Rho GEF (LARG).

AA Sequence

MALQLWALTLLGLLGAGASLRPRKLDFFRSEKELNHLAVDEASGVVYLGAVNALYQLDAKLQLEQQVATG      1 - 70
PALDNKKCTPPIEASQCHEAEMTDNVNQLLLLDPPRKRLVECGSLFKGICALRALSNISLRLFYEDGSGE     71 - 140
KSFVASNDEGVATVGLVSSTGPGGDRVLFVGKGNGPHDNGIIVSTRLLDRTDSREAFEAYTDHATYKAGY    141 - 210
LSTNTQQFVAAFEDGPYVFFVFNQQDKHPARNRTLLARMCREDPNYYSYLEMDLQCRDPDIHAAAFGTCL    211 - 280
AASVAAPGSGRVLYAVFSRDSRSSGGPGAGLCLFPLDKVHAKMEANRNACYTGTREARDIFYKPFHGDIQ    281 - 350
CGGHAPGSSKSFPCGSEHLPYPLGSRDGLRGTAVLQRGGLNLTAVTVAAENNHTVAFLGTSDGRILKVYL    351 - 420
TPDGTSSEYDSILVEINKRVKRDLVLSGDLGSLYAMTQDKVFRLPVQECLSYPTCTQCRDSQDPYCGWCV    421 - 490
VEGRCTRKAECPRAEEASHWLWSRSKSCVAVTSAQPQNMSRRAQGEVQLTVSPLPALSEEDELLCLFGES    491 - 560
PPHPARVEGEAVICNSPSSIPVTPPGQDHVAVTIQLLLRRGNIFLTSYQYPFYDCRQAMSLEENLPCISC    561 - 630
VSNRWTCQWDLRYHECREASPNPEDGIVRAHMEDSCPQFLGPSPLVIPMNHETDVNFQGKNLDTVKGSSL    631 - 700
HVGSDLLKFMEPVTMQESGTFAFRTPKLSHDANETLPLHLYVKSYGKNIDSKLHVTLYNCSFGRSDCSLC    701 - 770
RAANPDYRCAWCGGQSRCVYEALCNTTSECPPPVITRIQPETGPLGGGIRITILGSNLGVQAGDIQRISV    771 - 840
AGRNCSFQPERYSVSTRIVCVIEAAETPFTGGVEVDVFGKLGRSPPNVQFTFQQPKPLSVEPQQGPQAGG    841 - 910
TTLTIHGTHLDTGSQEDVRVTLNGVPCKVTKFGAQLQCVTGPQATRGQMLLEVSYGGSPVPNPGIFFTYR    911 - 980
ENPVLRAFEPLRSFASGGRSINVTGQGFSLIQRFAMVVIAEPLQSWQPPREAESLQPMTVVGTDYVFHND    981 - 1050
TKVVFLSPAVPEEPEAYNLTVLIEMDGHRALLRTEAGAFEYVPDPTFENFTGGVKKQVNKLIHARGTNLN   1051 - 1120
KAMTLQEAEAFVGAERCTMKTLTETDLYCEPPEVQPPPKRRQKRDTTHNLPEFIVKFGSREWVLGRVEYD   1121 - 1190
TRVSDVPLSLILPLVIVPMVVVIAVSVYCYWRKSQQAEREYEKIKSQLEGLEESVRDRCKKEFTDLMIEM   1191 - 1260
EDQTNDVHEAGIPVLDYKTYTDRVFFLPSKDGDKDVMITGKLDIPEPRRPVVEQALYQFSNLLNSKSFLI   1261 - 1330
NFIHTLENQREFSARAKVYFASLLTVALHGKLEYYTDIMHTLFLELLEQYVVAKNPKLMLRRSETVVERM   1331 - 1400
LSNWMSICLYQYLKDSAGEPLYKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQ   1401 - 1470
DEGVDAIPVKVLNCDTISQVKEKIIDQVYRGQPCSCWPRPDSVVLEWRPGSTAQILSDLDLTSQREGRWK   1471 - 1540
RVNTLMHYNVRDGATLILSKVGVSQQPEDSQQDLPGERHALLEEENRVWHLVRPTDEVDEGKSKRGSVKE   1541 - 1610
KERTKAITEIYLTRLLSVKGTLQQFVDNFFQSVLAPGHAVPPAVKYFFDFLDEQAEKHNIQDEDTIHIWK   1611 - 1680
TNSLPLRFWVNILKNPHFIFDVHVHEVVDASLSVIAQTFMDACTRTEHKLSRDSPSNKLLYAKEISTYKK   1681 - 1750
MVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQYTQKYYDEIINALEEDPAAQKMQL   1751 - 1820
AFRLQQIAAALENKVTDL                                                       1821 - 1838
//

Text Mined References (29)

PMID Year Title
26627240 2015 Secondary PDZ domain-binding site on class B plexins enhances the affinity for PDZ-RhoGEF.
26275342 2015 CD100 and plexins B2 and B1 mediate monocyte-endothelial cell adhesion and might take part in atherogenesis.
26035216 2015 Reduced expression of semaphorin 4D and plexin-B in breast cancer is associated with poorer prognosis and the potential linkage with oestrogen receptor.
25762646 2015 Plexin-B2 promotes invasive growth of malignant glioma.
25237006 2015 Endometrial apical glycoproteomic analysis reveals roles for cadherin 6, desmoglein-2 and plexin b2 in epithelial integrity.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24158112 2013 Experimental validation of 5 in-silico predicted glioma biomarkers.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
More...