Property Summary

NCBI Gene PubMed Count 17
Grant Count 11
Funding $1,078,798.72
PubMed Score 76.04
PubTator Score 12.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
gastric cancer 1.700 0.017
cutaneous lupus erythematosus -1.400 0.010
psoriasis -2.300 0.000
osteosarcoma 2.512 0.000
group 4 medulloblastoma -1.900 0.000
medulloblastoma, large-cell -1.300 0.031
non-small cell lung cancer -1.482 0.000
intraductal papillary-mucinous carcinoma... 1.400 0.003
active Crohn's disease 1.038 0.007
breast carcinoma -1.500 0.000
subependymal giant cell astrocytoma -1.443 0.027
lung adenocarcinoma -2.100 0.000
lung carcinoma -1.400 0.000
Pick disease 1.600 0.000
progressive supranuclear palsy -1.100 0.014
ductal carcinoma in situ -1.100 0.001
invasive ductal carcinoma -1.100 0.015
ovarian cancer -2.900 0.000
pituitary cancer -2.000 0.000

Gene RIF (10)

PMID Text
26143528 A significant association of ARHGEF10 with paclitaxel chemotherapy induced peripheral neuropathy was found.
21743172 the rs4376531 polymorphism in the ARHGEF10 gene is a risk factor for atherothrombotic stroke in the Han Chinese population
21719701 Identification of a negative regulatory region for the exchange activity and characterization of T332I mutant of Rho guanine nucleotide exchange factor 10 (ARHGEF10).
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20042462 The functional single-nucleotide polymorphism of ARHGEF10 confers the susceptibility to atherothrombotic stroke.
20042462 Observational study of gene-disease association. (HuGE Navigator)
19635168 A novel RhoA-dependent signaling pathway under the control of ARHGEF10 has a pivotal role in the regulation of the cell division cycle.
17893707 Observational study of gene-disease association. (HuGE Navigator)
16896804 Gef10 is the third member of a Rho-specific GEF family with unusual protein architecture
14508709 data support a role for ARHGEF10 in developmental myelination of peripheral nerves

AA Sequence

MRPPGFLSRAPSLNRAERGIWSCSMDQREPLPPAPAENEMKYDTNNNEEEEGEQFDFDSGDEIPEADRQA      1 - 70
PSAPETGGAGASEAPAPTGGEDGAGAETTPVAEPTKLVLPMKVNPYSVIDITPFQEDQPPTPVPSAEEEN     71 - 140
VGLHVPCGYLVPVPCGYAVPSNLPLLLPAYSSPVIICATSLDEEAETPEVTEDRQPNSLSSEEPPTSEDQ    141 - 210
VGREDSALARWAADPANTAWMENPEEAIYDDVPRENSDSEPDEMIYDDVENGDEGGNSSLEYGWSSSEFE    211 - 280
SYEEQSDSECKNGIPRSFLRSNHKKQLSHDLTRLKEHYEKKMRDLMASTVGVVEIQQLRQKHELKMQKLV    281 - 350
KAAKDGTKDGLERTRAAVKRGRSFIRTKSLIAQDHRSSLEEEQNLFIDVDCKHPEAILTPMPEGLSQQQV    351 - 420
VRRYILGSVVDSEKNYVDALKRILEQYEKPLSEMEPKVLSERKLKTVFYRVKEILQCHSLFQIALASRVS    421 - 490
EWDSVEMIGDVFVASFSKSMVLDAYSEYVNNFSTAVAVLKKTCATKPAFLEFLKQEQEASPDRTTLYSLM    491 - 560
MKPIQRFPQFILLLQDMLKNTSKGHPDRLPLQMALTELETLAEKLNERKRDADQRCEVKQIAKAINERYL    561 - 630
NKLLSSGSRYLIRSDDMIETVYNDRGEIVKTKERRVFMLNDVLMCATVSSRPSHDSRVMSSQRYLLKWSV    631 - 700
PLGHVDAIEYGSSAGTGEHSRHLAVHPPESLAVVANAKPNKVYMGPGQLYQDLQNLLHDLNVIGQITQLI    701 - 770
GNLKGNYQNLNQSVAHDWTSGLQRLILKKEDEIRAADCCRIQLQLPGKQDKSGRPTFFTAVFNTFTPAIK    771 - 840
ESWVNSLQMAKLALEEENHMGWFCVEDDGNHIKKEKHPLLVGHMPVMVAKQQEFKIECAAYNPEPYLNNE    841 - 910
SQPDSFSTAHGFLWIGSCTHQMGQIAIVSFQNSTPKVIECFNVESRILCMLYVPVEEKRREPGAPPDPET    911 - 980
PAVRASDVPTICVGTEEGSISIYKSSQGSKKVRLQHFFTPEKSTVMSLACTSQSLYAGLVNGAVASYARA    981 - 1050
PDGSWDSEPQKVIKLGVLPVRSLLMMEDTLWAASGGQVFIISVETHAVEGQLEAHQEEGMVISHMAVSGV   1051 - 1120
GIWIAFTSGSTLRLFHTETLKHLQDINIATPVHNMLPGHQRLSVTSLLVCHGLLMVGTSLGVLVALPVPR   1121 - 1190
LQGIPKVTGRGMVSYHAHNSPVKFIVLATALHEKDKDKSRDSLAPGPEPQDEDQKDALPSGGAGSSLSQG   1191 - 1260
DPDAAIWLGDSLGSMTQKSDLSSSSGSLSLSHGSSSLEHRSEDSTIYDLLKDPVSLRSKARRAKKAKASS   1261 - 1330
ALVVCGGQGHRRVHRKARQPHQEELAPTVMVWQIPLLNI                                  1331 - 1369
//

Text Mined References (23)

PMID Year Title
26143528 2015 Association of the Charcot-Marie-Tooth disease gene ARHGEF10 with paclitaxel induced peripheral neuropathy in NCCTG N08CA (Alliance).
25343990 2015 Genome-wide association study of selenium concentrations.
24627108 2014 Whole-exome sequencing in patients with inherited neuropathies: outcome and challenges.
23412934 2013 A genome-wide association study of brain lesion distribution in multiple sclerosis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21743172 The functional SNP rs4376531 in the ARHGEF gene is a risk factor for the atherothrombotic stroke in Han Chinese.
21719701 2011 Identification of a negative regulatory region for the exchange activity and characterization of T332I mutant of Rho guanine nucleotide exchange factor 10 (ARHGEF10).
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20042462 2010 Functional SNP of ARHGEF10 confers risk of atherothrombotic stroke.
More...