Property Summary

NCBI Gene PubMed Count 17
PubMed Score 76.04
PubTator Score 12.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
lung adenocarcinoma 2714 8.37640752827236E-19
ovarian cancer 8492 3.40732118904271E-17
non-small cell lung cancer 2798 2.73456465650474E-16
lung carcinoma 2844 5.22342911441862E-15
breast carcinoma 1614 5.13847232050558E-7
pituitary cancer 1972 3.49883424938035E-6
group 4 medulloblastoma 1875 1.26123200590798E-5
Pick disease 1893 2.75423093769653E-5
osteosarcoma 7933 6.5253832379257E-5
psoriasis 6685 7.62686528120047E-5
ductal carcinoma in situ 1745 0.00145996549888822
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00349658728601746
active Crohn's disease 918 0.0069750389057721
cutaneous lupus erythematosus 1056 0.00981525066855951
progressive supranuclear palsy 674 0.0139237857473377
invasive ductal carcinoma 2950 0.0149096022026431
gastric cancer 436 0.0167381035499831
subependymal giant cell astrocytoma 2287 0.0269591080135445
medulloblastoma, large-cell 6234 0.0311266981859967
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 147 0.0 1.0
Multiple Sclerosis 498 0.0 1.0
Disease Target Count
Slowed nerve conduction velocity 1

Expression

  Differential Expression (19)

Disease log2 FC p
gastric cancer 1.700 0.017
cutaneous lupus erythematosus -1.400 0.010
psoriasis -2.300 0.000
osteosarcoma 2.512 0.000
group 4 medulloblastoma -1.900 0.000
medulloblastoma, large-cell -1.300 0.031
non-small cell lung cancer -1.482 0.000
intraductal papillary-mucinous carcinoma... 1.400 0.003
active Crohn's disease 1.038 0.007
breast carcinoma -1.500 0.000
subependymal giant cell astrocytoma -1.443 0.027
lung adenocarcinoma -2.100 0.000
lung carcinoma -1.400 0.000
Pick disease 1.600 0.000
progressive supranuclear palsy -1.100 0.014
ductal carcinoma in situ -1.100 0.001
invasive ductal carcinoma -1.100 0.015
ovarian cancer -2.900 0.000
pituitary cancer -2.000 0.000

Synonym

Accession O15013 O14665 Q2KHR8 Q68D55 Q8IWD9 Q8IY77
Symbols SNCV
GEF10

Gene

PANTHER Protein Class (3)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA Inparanoid
Pig EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (10)

PMID Text
26143528 A significant association of ARHGEF10 with paclitaxel chemotherapy induced peripheral neuropathy was found.
21743172 the rs4376531 polymorphism in the ARHGEF10 gene is a risk factor for atherothrombotic stroke in the Han Chinese population
21719701 Identification of a negative regulatory region for the exchange activity and characterization of T332I mutant of Rho guanine nucleotide exchange factor 10 (ARHGEF10).
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20042462 The functional single-nucleotide polymorphism of ARHGEF10 confers the susceptibility to atherothrombotic stroke.
20042462 Observational study of gene-disease association. (HuGE Navigator)
19635168 A novel RhoA-dependent signaling pathway under the control of ARHGEF10 has a pivotal role in the regulation of the cell division cycle.
17893707 Observational study of gene-disease association. (HuGE Navigator)
16896804 Gef10 is the third member of a Rho-specific GEF family with unusual protein architecture
14508709 data support a role for ARHGEF10 in developmental myelination of peripheral nerves

AA Sequence

MRPPGFLSRAPSLNRAERGIWSCSMDQREPLPPAPAENEMKYDTNNNEEEEGEQFDFDSGDEIPEADRQA      1 - 70
PSAPETGGAGASEAPAPTGGEDGAGAETTPVAEPTKLVLPMKVNPYSVIDITPFQEDQPPTPVPSAEEEN     71 - 140
VGLHVPCGYLVPVPCGYAVPSNLPLLLPAYSSPVIICATSLDEEAETPEVTEDRQPNSLSSEEPPTSEDQ    141 - 210
VGREDSALARWAADPANTAWMENPEEAIYDDVPRENSDSEPDEMIYDDVENGDEGGNSSLEYGWSSSEFE    211 - 280
SYEEQSDSECKNGIPRSFLRSNHKKQLSHDLTRLKEHYEKKMRDLMASTVGVVEIQQLRQKHELKMQKLV    281 - 350
KAAKDGTKDGLERTRAAVKRGRSFIRTKSLIAQDHRSSLEEEQNLFIDVDCKHPEAILTPMPEGLSQQQV    351 - 420
VRRYILGSVVDSEKNYVDALKRILEQYEKPLSEMEPKVLSERKLKTVFYRVKEILQCHSLFQIALASRVS    421 - 490
EWDSVEMIGDVFVASFSKSMVLDAYSEYVNNFSTAVAVLKKTCATKPAFLEFLKQEQEASPDRTTLYSLM    491 - 560
MKPIQRFPQFILLLQDMLKNTSKGHPDRLPLQMALTELETLAEKLNERKRDADQRCEVKQIAKAINERYL    561 - 630
NKLLSSGSRYLIRSDDMIETVYNDRGEIVKTKERRVFMLNDVLMCATVSSRPSHDSRVMSSQRYLLKWSV    631 - 700
PLGHVDAIEYGSSAGTGEHSRHLAVHPPESLAVVANAKPNKVYMGPGQLYQDLQNLLHDLNVIGQITQLI    701 - 770
GNLKGNYQNLNQSVAHDWTSGLQRLILKKEDEIRAADCCRIQLQLPGKQDKSGRPTFFTAVFNTFTPAIK    771 - 840
ESWVNSLQMAKLALEEENHMGWFCVEDDGNHIKKEKHPLLVGHMPVMVAKQQEFKIECAAYNPEPYLNNE    841 - 910
SQPDSFSTAHGFLWIGSCTHQMGQIAIVSFQNSTPKVIECFNVESRILCMLYVPVEEKRREPGAPPDPET    911 - 980
PAVRASDVPTICVGTEEGSISIYKSSQGSKKVRLQHFFTPEKSTVMSLACTSQSLYAGLVNGAVASYARA    981 - 1050
PDGSWDSEPQKVIKLGVLPVRSLLMMEDTLWAASGGQVFIISVETHAVEGQLEAHQEEGMVISHMAVSGV   1051 - 1120
GIWIAFTSGSTLRLFHTETLKHLQDINIATPVHNMLPGHQRLSVTSLLVCHGLLMVGTSLGVLVALPVPR   1121 - 1190
LQGIPKVTGRGMVSYHAHNSPVKFIVLATALHEKDKDKSRDSLAPGPEPQDEDQKDALPSGGAGSSLSQG   1191 - 1260
DPDAAIWLGDSLGSMTQKSDLSSSSGSLSLSHGSSSLEHRSEDSTIYDLLKDPVSLRSKARRAKKAKASS   1261 - 1330
ALVVCGGQGHRRVHRKARQPHQEELAPTVMVWQIPLLNI                                  1331 - 1369
//

Text Mined References (23)

PMID Year Title
26143528 2015 Association of the Charcot-Marie-Tooth disease gene ARHGEF10 with paclitaxel induced peripheral neuropathy in NCCTG N08CA (Alliance).
25343990 2015 Genome-wide association study of selenium concentrations.
24627108 2014 Whole-exome sequencing in patients with inherited neuropathies: outcome and challenges.
23412934 2013 A genome-wide association study of brain lesion distribution in multiple sclerosis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21743172 The functional SNP rs4376531 in the ARHGEF gene is a risk factor for the atherothrombotic stroke in Han Chinese.
21719701 2011 Identification of a negative regulatory region for the exchange activity and characterization of T332I mutant of Rho guanine nucleotide exchange factor 10 (ARHGEF10).
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20042462 2010 Functional SNP of ARHGEF10 confers risk of atherothrombotic stroke.
More...