Property Summary

NCBI Gene PubMed Count 19
PubMed Score 86.09
PubTator Score 12.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Slowed Nerve Conduction Velocity, Autosomal Dominant 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 184 0.0 1.2
Multiple Sclerosis 540 0.0 1.7

Expression

  Differential Expression (19)

Disease log2 FC p
active Crohn's disease 1.038 7.0e-03
breast carcinoma -1.500 5.1e-07
cutaneous lupus erythematosus -1.400 9.8e-03
ductal carcinoma in situ -1.100 1.5e-03
gastric cancer 1.700 1.7e-02
group 3 medulloblastoma -1.400 1.1e-02
intraductal papillary-mucinous carcinoma... 1.400 3.5e-03
invasive ductal carcinoma -1.100 1.5e-02
lung adenocarcinoma -2.100 8.4e-19
lung carcinoma -1.400 5.2e-15
medulloblastoma, large-cell -1.300 3.1e-02
non-small cell lung cancer -1.482 2.7e-16
osteosarcoma 2.273 6.7e-06
ovarian cancer -2.900 3.4e-17
Pick disease 1.400 4.4e-05
pituitary cancer -2.000 3.5e-06
progressive supranuclear palsy -1.100 1.4e-02
psoriasis -2.300 7.6e-05
subependymal giant cell astrocytoma -1.443 2.7e-02

Protein-protein Interaction (6)

Gene RIF (12)

AA Sequence

MRPPGFLSRAPSLNRAERGIWSCSMDQREPLPPAPAENEMKYDTNNNEEEEGEQFDFDSGDEIPEADRQA      1 - 70
PSAPETGGAGASEAPAPTGGEDGAGAETTPVAEPTKLVLPMKVNPYSVIDITPFQEDQPPTPVPSAEEEN     71 - 140
VGLHVPCGYLVPVPCGYAVPSNLPLLLPAYSSPVIICATSLDEEAETPEVTEDRQPNSLSSEEPPTSEDQ    141 - 210
VGREDSALARWAADPANTAWMENPEEAIYDDVPRENSDSEPDEMIYDDVENGDEGGNSSLEYGWSSSEFE    211 - 280
SYEEQSDSECKNGIPRSFLRSNHKKQLSHDLTRLKEHYEKKMRDLMASTVGVVEIQQLRQKHELKMQKLV    281 - 350
KAAKDGTKDGLERTRAAVKRGRSFIRTKSLIAQDHRSSLEEEQNLFIDVDCKHPEAILTPMPEGLSQQQV    351 - 420
VRRYILGSVVDSEKNYVDALKRILEQYEKPLSEMEPKVLSERKLKTVFYRVKEILQCHSLFQIALASRVS    421 - 490
EWDSVEMIGDVFVASFSKSMVLDAYSEYVNNFSTAVAVLKKTCATKPAFLEFLKQEQEASPDRTTLYSLM    491 - 560
MKPIQRFPQFILLLQDMLKNTSKGHPDRLPLQMALTELETLAEKLNERKRDADQRCEVKQIAKAINERYL    561 - 630
NKLLSSGSRYLIRSDDMIETVYNDRGEIVKTKERRVFMLNDVLMCATVSSRPSHDSRVMSSQRYLLKWSV    631 - 700
PLGHVDAIEYGSSAGTGEHSRHLAVHPPESLAVVANAKPNKVYMGPGQLYQDLQNLLHDLNVIGQITQLI    701 - 770
GNLKGNYQNLNQSVAHDWTSGLQRLILKKEDEIRAADCCRIQLQLPGKQDKSGRPTFFTAVFNTFTPAIK    771 - 840
ESWVNSLQMAKLALEEENHMGWFCVEDDGNHIKKEKHPLLVGHMPVMVAKQQEFKIECAAYNPEPYLNNE    841 - 910
SQPDSFSTAHGFLWIGSCTHQMGQIAIVSFQNSTPKVIECFNVESRILCMLYVPVEEKRREPGAPPDPET    911 - 980
PAVRASDVPTICVGTEEGSISIYKSSQGSKKVRLQHFFTPEKSTVMSLACTSQSLYAGLVNGAVASYARA    981 - 1050
PDGSWDSEPQKVIKLGVLPVRSLLMMEDTLWAASGGQVFIISVETHAVEGQLEAHQEEGMVISHMAVSGV   1051 - 1120
GIWIAFTSGSTLRLFHTETLKHLQDINIATPVHNMLPGHQRLSVTSLLVCHGLLMVGTSLGVLVALPVPR   1121 - 1190
LQGIPKVTGRGMVSYHAHNSPVKFIVLATALHEKDKDKSRDSLAPGPEPQDEDQKDALPSGGAGSSLSQG   1191 - 1260
DPDAAIWLGDSLGSMTQKSDLSSSSGSLSLSHGSSSLEHRSEDSTIYDLLKDPVSLRSKARRAKKAKASS   1261 - 1330
ALVVCGGQGHRRVHRKARQPHQEELAPTVMVWQIPLLNI                                  1331 - 1369
//

Text Mined References (25)

PMID Year Title