Property Summary

NCBI Gene PubMed Count 23
PubMed Score 11.12
PubTator Score 100.97

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O14979 Q6SPF2 Q7KZ74 Q7KZ75 Q96IM0 Q96S43 hnRNP D-like
Symbols HNRNP
JKTBP
HNRPDL
JKTBP2
LGMD1G
laAUF1

Gene

Gene RIF (10)

PMID Text
24647604 A defect in the RNA-processing protein HNRPDL causes limb-girdle muscular dystrophy 1G.
23642268 hnRNP DL and CNBP are novel antigens for SLE patients
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
22174317 HIV-1 Rev interacting protein, heterogeneous nuclear ribonucleoprotein D-like (HNRPDL), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with HNRPDL is increased by RRE
21300069 The results indicate that JKTBP1 regulates the level of NRF protein expression by binding to both NRF 5' and 3' UTRs.
18854154 Knockdown of heterogeneous nuclear ribonucleoprotein D-like (HNRPDL) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18381662 overexpression of JKTBP1 in LNCaP cells leads to abnormal cell proliferation
18095154 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17592041 The data of this study show that JKTBP1 and the 14-nt element act independently to mediate NRF internal ribosome entry segment activity.
16011250 Study shows that there is interaction of the intracellular domain of beta-amyloid precursor protein with JKTBP2, indicating that JKTBP2 may have an important function in AD formation.

AA Sequence

MEVPPRLSHVPPPLFPSAPATLASRSLSHWRPRPPRQLAPLLPSLAPSSARQGARRAQRHVTAQQPSRLA      1 - 70
GGAAIKGGRRRRPDLFRRHFKSSSIQRSAAAAAATRTARQHPPADSSVTMEDMNEYSNIEEFAEGSKINA     71 - 140
SKNQQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKE    141 - 210
HKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFIT    211 - 280
YTDEEPVKKLLESRYHQIGSGKCEIKVAQPKEVYRQQQQQQKGGRGAAAGGRGGTRGRGRGQGQNWNQGF    281 - 350
NNYYDQGYGNYNSAYGGDQNYSGYGGYDYTGYNYGNYGYGQGYADYSGQQSTYGKASRGGGNHQNNYQPY    351 - 420
//

Text Mined References (36)

PMID Year Title
26420826 2015 Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.
24647604 2014 A defect in the RNA-processing protein HNRPDL causes limb-girdle muscular dystrophy 1G (LGMD1G).
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23642268 2013 Proteomic analyses and identification of arginine methylated proteins differentially recognized by autosera from anti-Sm positive SLE patients.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
More...