Property Summary

NCBI Gene PubMed Count 23
PubMed Score 11.06
PubTator Score 100.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Limb-Girdle Muscular Dystrophy, Type 1G 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
limb-girdle muscular dystrophy 37 3.457 1.7
Disease Target Count Z-score Confidence
Chromosome 4q21 deletion syndrome 6 5.794 2.9

Expression

  Differential Expression (25)

Disease log2 FC p
astrocytic glioma 1.600 2.0e-02
Astrocytoma, Pilocytic 1.200 1.5e-03
atypical teratoid/rhabdoid tumor 1.500 2.0e-04
Breast cancer -1.200 3.7e-11
dermatomyositis 1.400 1.6e-04
ependymoma 1.900 1.6e-02
glioblastoma 1.100 3.6e-04
group 3 medulloblastoma 1.600 2.7e-02
interstitial lung disease -1.500 1.1e-03
lung adenocarcinoma -1.400 3.7e-10
lung cancer -1.400 6.0e-05
malignant mesothelioma 1.500 4.6e-07
medulloblastoma, large-cell 1.900 4.3e-06
Multiple myeloma 2.279 6.7e-06
non-small cell lung cancer -1.004 8.0e-14
ovarian cancer -1.300 3.0e-04
pancreatic cancer -1.300 3.1e-05
pancreatic carcinoma -1.300 3.1e-05
pediatric high grade glioma 1.300 1.5e-03
Pick disease -1.300 8.6e-06
primitive neuroectodermal tumor 1.400 2.5e-06
progressive supranuclear palsy -1.300 1.8e-02
subependymal giant cell astrocytoma -1.320 3.9e-02
tuberculosis and treatment for 3 months 1.100 4.5e-06
Waldenstrons macroglobulinemia 1.573 2.0e-03

Protein-protein Interaction (10)

Gene RIF (10)

AA Sequence

MEVPPRLSHVPPPLFPSAPATLASRSLSHWRPRPPRQLAPLLPSLAPSSARQGARRAQRHVTAQQPSRLA      1 - 70
GGAAIKGGRRRRPDLFRRHFKSSSIQRSAAAAAATRTARQHPPADSSVTMEDMNEYSNIEEFAEGSKINA     71 - 140
SKNQQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKE    141 - 210
HKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFIT    211 - 280
YTDEEPVKKLLESRYHQIGSGKCEIKVAQPKEVYRQQQQQQKGGRGAAAGGRGGTRGRGRGQGQNWNQGF    281 - 350
NNYYDQGYGNYNSAYGGDQNYSGYGGYDYTGYNYGNYGYGQGYADYSGQQSTYGKASRGGGNHQNNYQPY    351 - 420
//

Text Mined References (37)

PMID Year Title