Property Summary

NCBI Gene PubMed Count 10
PubMed Score 11.72
PubTator Score 8.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.0e-03
Disease Target Count Z-score Confidence
Down syndrome 499 4.989 2.5
Peanut allergy 11 3.566 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.100 1.0e-03

Synonym

Accession O14972 B2R6T8 B7Z6B1 D3DSH4 Q2TAY6
Symbols DCRA
DSCR3
DSCRA

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MGTALDIKIKRANKVYHAGEVLSGVVVISSKDSVQHQGVSLTMEGTVNLQLSAKSVGVFEAFYNSVKPIQ      1 - 70
IINSTIEMVKPGKFPSGKTEIPFEFPLHLKGNKVLYETYHGVFVNIQYTLRCDMKRSLLAKDLTKTCEFI     71 - 140
VHSAPQKGKFTPSPVDFTITPETLQNVKERALLPKFLLRGHLNSTNCVITQPLTGELVVESSEAAIRSVE    141 - 210
LQLVRVETCGCAEGYARDATEIQNIQIADGDVCRGLSVPIYMVFPRLFTCPTLETTNFKVEFEVNIVVLL    211 - 280
HPDHLITENFPLKLCRI                                                         281 - 297
//

Text Mined References (11)

PMID Year Title