Property Summary

NCBI Gene PubMed Count 8
PubMed Score 16.34
PubTator Score 8.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.100 0.001

AA Sequence

MGTALDIKIKRANKVYHAGEVLSGVVVISSKDSVQHQGVSLTMEGTVNLQLSAKSVGVFEAFYNSVKPIQ      1 - 70
IINSTIEMVKPGKFPSGKTEIPFEFPLHLKGNKVLYETYHGVFVNIQYTLRCDMKRSLLAKDLTKTCEFI     71 - 140
VHSAPQKGKFTPSPVDFTITPETLQNVKERALLPKFLLRGHLNSTNCVITQPLTGELVVESSEAAIRSVE    141 - 210
LQLVRVETCGCAEGYARDATEIQNIQIADGDVCRGLSVPIYMVFPRLFTCPTLETTNFKVEFEVNIVVLL    211 - 280
HPDHLITENFPLKLCRI                                                         281 - 297
//

Text Mined References (9)

PMID Year Title
19794886 2009 The arrestin fold: variations on a theme.
16780588 2006 Cell array-based intracellular localization screening reveals novel functional features of human chromosome 21 proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10830953 2000 The DNA sequence of human chromosome 21.
9503011 1998 Transcriptional map of the 2.5-Mb CBR-ERG region of chromosome 21 involved in Down syndrome.
9399594 1997 Isolation of a novel human gene from the Down syndrome critical region of chromosome 21q22.2.