Property Summary

NCBI Gene PubMed Count 22
Grant Count 20
R01 Count 16
Funding $1,652,304.62
PubMed Score 25.17
PubTator Score 18.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Cleft Lip 91 4.921 2.5
Cleft palate 125 4.123 2.1

Expression

 GO Function (1)

Gene RIF (12)

PMID Text
26075712 This association study successfully identified two susceptibility Single Nucleotide Polymorphisms, (WNT9B and PBX1) associated with Mayer-Rokitansky-Kuster-Hauser syndrome risk, both separately and interactively.
24852367 Genome association study shows a highly conserved 32 kb intergenic region containing regulatory elements between WNT3 and WNT9B in patients with classic bladder exstrophy.
24581601 results indicate that mutations in the coding sequence of WNT9B are not responsible for Mullerian duct abnormalities in the Chinese population
24268733 Two novel mutations (a missense mutation in exon 1, and one in the 3-UTR) may be pathogenic variants in Mayer-Rokitansky-Kuster-Hauser syndrome patients and warrant further functional study.
23974041 The signals from the stromal fibroblasts cooperate with Wnt9b to promote differentiation of the progenitor cells.
23785285 secretion of WNT2B and WNT9B and stabilization of beta-catenin (CTNNB1) upon virus infection negatively regulate expression of representative inducible genes IFNB1, IFIT1 and TNF in a CTNNB1-dependent effector mechanism
20890934 Observational study of gene-disease association. (HuGE Navigator)
20672350 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MRPPPALALAGLCLLALPAAAASYFGLTGREVLTPFPGLGTAAAPAQGGAHLKQCDLLKLSRRQKQLCRR      1 - 70
EPGLAETLRDAAHLGLLECQFQFRHERWNCSLEGRMGLLKRGFKETAFLYAVSSAALTHTLARACSAGRM     71 - 140
ERCTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGSKRGNKDLRARADAHNTHVGIKAVKSGLRTTC    141 - 210
KCHGVSGSCAVRTCWKQLSPFRETGQVLKLRYDSAVKVSSATNEALGRLELWAPARQGSLTKGLAPRSGD    211 - 280
LVYMEDSPSFCRPSKYSPGTAGRVCSREASCSSLCCGRGYDTQSRLVAFSCHCQVQWCCYVECQQCVQEE    281 - 350
LVYTCKH                                                                   351 - 357
//

Text Mined References (24)

PMID Year Title
26075712 2015 Associations of Polymorphisms in WNT9B and PBX1 with Mayer-Rokitansky-Küster-Hauser Syndrome in Chinese Han.
25640183 2015 Functional consequences of 17q21.31/WNT3-WNT9B amplification in hPSCs with respect to neural differentiation.
24852367 2014 Genome-wide association study and mouse expression data identify a highly conserved 32 kb intergenic region between WNT3 and WNT9b as possible susceptibility locus for isolated classic exstrophy of the bladder.
24581601 2014 WNT9B in 542 Chinese women with Müllerian duct abnormalities: mutation analysis.
24268733 2014 Analysis of WNT9B mutations in Chinese women with Mayer-Rokitansky-Küster-Hauser syndrome.
23974041 2013 Stromal-epithelial crosstalk regulates kidney progenitor cell differentiation.
23785285 2013 Genome-wide RNAi screen reveals a new role of a WNT/CTNNB1 signaling pathway as negative regulator of virus-induced innate immune responses.
22808956 2012 Genetically distinct subsets within ANCA-associated vasculitis.
20890934 2010 Studies with Wnt genes and nonsyndromic cleft lip and palate.
20672350 2010 Genetic variants in COL2A1, COL11A2, and IRF6 contribute risk to nonsyndromic cleft palate.
More...