Tbio | Protein Wnt-9b |
Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters (By similarity).
The WNT gene family consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. Study of its expression in the teratocarcinoma cell line NT2 suggests that it may be implicated in the early process of neuronal differentiation of NT2 cells induced by retinoic acid. This gene is clustered with WNT3, another family member, in the chromosome 17q21 region. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]
The WNT gene family consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. Study of its expression in the teratocarcinoma cell line NT2 suggests that it may be implicated in the early process of neuronal differentiation of NT2 cells induced by retinoic acid. This gene is clustered with WNT3, another family member, in the chromosome 17q21 region. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]
Comments
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Chicken | OMA Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG |
Xenopus | OMA Inparanoid |
PMID | Text |
---|---|
26075712 | This association study successfully identified two susceptibility Single Nucleotide Polymorphisms, (WNT9B and PBX1) associated with Mayer-Rokitansky-Kuster-Hauser syndrome risk, both separately and interactively. |
24852367 | Genome association study shows a highly conserved 32 kb intergenic region containing regulatory elements between WNT3 and WNT9B in patients with classic bladder exstrophy. |
24581601 | results indicate that mutations in the coding sequence of WNT9B are not responsible for Mullerian duct abnormalities in the Chinese population |
24268733 | Two novel mutations (a missense mutation in exon 1, and one in the 3-UTR) may be pathogenic variants in Mayer-Rokitansky-Kuster-Hauser syndrome patients and warrant further functional study. |
23974041 | The signals from the stromal fibroblasts cooperate with Wnt9b to promote differentiation of the progenitor cells. |
23785285 | secretion of WNT2B and WNT9B and stabilization of beta-catenin (CTNNB1) upon virus infection negatively regulate expression of representative inducible genes IFNB1, IFIT1 and TNF in a CTNNB1-dependent effector mechanism |
20890934 | Observational study of gene-disease association. (HuGE Navigator) |
20672350 | Observational study of gene-disease association. (HuGE Navigator) |
20634891 | Observational study of gene-disease association. (HuGE Navigator) |
20379614 | Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) |
More... |
MRPPPALALAGLCLLALPAAAASYFGLTGREVLTPFPGLGTAAAPAQGGAHLKQCDLLKLSRRQKQLCRR 1 - 70 EPGLAETLRDAAHLGLLECQFQFRHERWNCSLEGRMGLLKRGFKETAFLYAVSSAALTHTLARACSAGRM 71 - 140 ERCTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGSKRGNKDLRARADAHNTHVGIKAVKSGLRTTC 141 - 210 KCHGVSGSCAVRTCWKQLSPFRETGQVLKLRYDSAVKVSSATNEALGRLELWAPARQGSLTKGLAPRSGD 211 - 280 LVYMEDSPSFCRPSKYSPGTAGRVCSREASCSSLCCGRGYDTQSRLVAFSCHCQVQWCCYVECQQCVQEE 281 - 350 LVYTCKH 351 - 357 //
PMID | Year | Title |
---|---|---|
26075712 | 2015 | Associations of Polymorphisms in WNT9B and PBX1 with Mayer-Rokitansky-Küster-Hauser Syndrome in Chinese Han. |
25640183 | 2015 | Functional consequences of 17q21.31/WNT3-WNT9B amplification in hPSCs with respect to neural differentiation. |
24852367 | 2014 | Genome-wide association study and mouse expression data identify a highly conserved 32 kb intergenic region between WNT3 and WNT9b as possible susceptibility locus for isolated classic exstrophy of the bladder. |
24581601 | 2014 | WNT9B in 542 Chinese women with Müllerian duct abnormalities: mutation analysis. |
24268733 | 2014 | Analysis of WNT9B mutations in Chinese women with Mayer-Rokitansky-Küster-Hauser syndrome. |
23974041 | 2013 | Stromal-epithelial crosstalk regulates kidney progenitor cell differentiation. |
23785285 | 2013 | Genome-wide RNAi screen reveals a new role of a WNT/CTNNB1 signaling pathway as negative regulator of virus-induced innate immune responses. |
22808956 | 2012 | Genetically distinct subsets within ANCA-associated vasculitis. |
20890934 | 2010 | Studies with Wnt genes and nonsyndromic cleft lip and palate. |
20672350 | 2010 | Genetic variants in COL2A1, COL11A2, and IRF6 contribute risk to nonsyndromic cleft palate. |
More... |