Property Summary

NCBI Gene PubMed Count 24
PubMed Score 27.30
PubTator Score 18.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Vascular disease 319 0.0 0.7
Disease Target Count Z-score Confidence
Cleft Lip 141 5.065 2.5
Cleft Palate 271 4.375 2.2
Bladder exstrophy 32 3.038 1.5

Expression

Protein-protein Interaction (3)

Gene RIF (13)

AA Sequence

MRPPPALALAGLCLLALPAAAASYFGLTGREVLTPFPGLGTAAAPAQGGAHLKQCDLLKLSRRQKQLCRR      1 - 70
EPGLAETLRDAAHLGLLECQFQFRHERWNCSLEGRMGLLKRGFKETAFLYAVSSAALTHTLARACSAGRM     71 - 140
ERCTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGSKRGNKDLRARADAHNTHVGIKAVKSGLRTTC    141 - 210
KCHGVSGSCAVRTCWKQLSPFRETGQVLKLRYDSAVKVSSATNEALGRLELWAPARQGSLTKGLAPRSGD    211 - 280
LVYMEDSPSFCRPSKYSPGTAGRVCSREASCSSLCCGRGYDTQSRLVAFSCHCQVQWCCYVECQQCVQEE    281 - 350
LVYTCKH                                                                   351 - 357
//

Text Mined References (26)

PMID Year Title