Property Summary

NCBI Gene PubMed Count 40
PubMed Score 35.14
PubTator Score 36.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
non-small cell lung cancer 2798 1.73378402522695E-15
malignant mesothelioma 3163 9.07332595849775E-7
lung cancer 4473 5.22855657410584E-4
psoriasis 6685 6.92008881569388E-4
group 3 medulloblastoma 2254 0.00375132871424751
Disease Target Count Z-score Confidence
Muscular atrophy 67 5.853 2.9
Neurodegenerative disease 383 3.695 1.8

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
psoriasis -1.700 0.001
non-small cell lung cancer 1.078 0.000
lung cancer 2.400 0.001
group 3 medulloblastoma 1.100 0.004

Synonym

Accession O14893 B2R9W8 Q2M3B3 Q9H4F5 Q9NS77 Q9NS78 Q9NS79 Gemin-2
Symbols SIP1
SIP1-delta

Gene

PDB

3S6N   2LEH  

  Ortholog (16)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly OMA Inparanoid

Gene RIF (25)

PMID Text
26828962 The authors propose that Gemin2 is a versatile hub for ribonucleoprotein exchange that functions broadly in RNA metabolism.
26092730 investigate the oligomeric nature of the SMN.Gemin2 complexes from humans and fission yeast (hSMN.Gemin2 and ySMN.Gemin2)
23939045 Two monoclonal antibodies against SMN (survival-of-motor-neurons) protein bind to its site of interaction with gemin2.
22607171 several conserved SMN residues, including the sites of two SMA patient mutations, are not required for binding to Gemin2. Instead, they form a conserved SMN/Gemin2 surface that may be functionally important for snRNP assembly.
22190034 HIV-1 Vpr is identified to have a physical interaction with gem (nuclear organelle) associated protein 2 (GEMIN2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21994574 HIV-1 Vpr is identified to have a physical interaction with gem (nuclear organelle) associated protein 2 (GEMIN2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21972558 HIV-1 Vpr is identified to have a physical interaction with gem (nuclear organelle) associated protein 2 (GEMIN2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21913013 Overexpression of SIP1 and downregulation of E-cadherin is associated with delayed neck metastasis in stage I/II oral tongue squamous cell carcinoma after partial glossectomy
21816274 Study identified Gemin2 as the protein that binds a pentamer of Sm proteins comprised of SmD1/D2 and SmF/E/G; the crystal structure of this complex bound to SMN's Gemin2 binding domain to 2.5 A was determined.
21732698 purified SMN-GEMIN2 fusion protein enhanced the RAD51-mediated homologous pairing much more efficiently than GEMIN2 alone
More...

AA Sequence

MRRAELAGLKTMAWVPAESAVEELMPRLLPVEPCDLTEGFDPSVPPRTPQEYLRRVQIEAAQCPDVVVAQ      1 - 70
IDPKKLKRKQSVNISLSGCQPAPEGYSPTLQWQQQQVAQFSTVRQNVNKHRSHWKSQQLDSNVTMPKSED     71 - 140
EEGWKKFCLGEKLCADGAVGPATNESPGIDYVQIGFPPLLSIVSRMNQATVTSVLEYLSNWFGERDFTPE    141 - 210
LGRWLYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS    211 - 280
//

Text Mined References (46)

PMID Year Title
26828962 2016 A U1 snRNP-specific assembly pathway reveals the SMN complex as a versatile hub for RNP exchange.
26092730 2015 Oligomeric Properties of Survival Motor Neuron·Gemin2 Complexes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23939045 2013 The gemin2-binding site on SMN protein: accessibility to antibody.
22607171 2012 Solution structure of the core SMN-Gemin2 complex.
21913013 2012 Overexpression of SIP1 and downregulation of E-cadherin predict delayed neck metastasis in stage I/II oral tongue squamous cell carcinoma after partial glossectomy.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21816274 2011 Structure of a key intermediate of the SMN complex reveals Gemin2's crucial function in snRNP assembly.
21732698 2011 Purification of the human SMN-GEMIN2 complex and assessment of its stimulation of RAD51-mediated DNA recombination reactions.
21269460 2011 Initial characterization of the human central proteome.
More...