Property Summary

NCBI Gene PubMed Count 43
PubMed Score 35.35
PubTator Score 36.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.100 3.8e-03
lung cancer 2.000 2.8e-03
malignant mesothelioma 1.300 9.1e-07
non-small cell lung cancer 1.060 8.7e-12
psoriasis -1.700 6.9e-04

Gene RIF (27)

AA Sequence

MRRAELAGLKTMAWVPAESAVEELMPRLLPVEPCDLTEGFDPSVPPRTPQEYLRRVQIEAAQCPDVVVAQ      1 - 70
IDPKKLKRKQSVNISLSGCQPAPEGYSPTLQWQQQQVAQFSTVRQNVNKHRSHWKSQQLDSNVTMPKSED     71 - 140
EEGWKKFCLGEKLCADGAVGPATNESPGIDYVQIGFPPLLSIVSRMNQATVTSVLEYLSNWFGERDFTPE    141 - 210
LGRWLYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS    211 - 280
//

Text Mined References (49)

PMID Year Title