Property Summary

NCBI Gene PubMed Count 9
PubMed Score 12.89
PubTator Score 8.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma, Renal Cell 124 0.0 0.0
Disease Target Count
Renal Cell Carcinoma 214
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Osteonecrosis 27 3.305 1.7
Myocarditis 18 3.019 1.5

Expression

  Differential Expression (9)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 1.3e-04
atypical teratoid / rhabdoid tumor 1.400 4.1e-06
ependymoma 1.400 1.3e-09
glioblastoma 1.300 1.1e-05
hepatocellular carcinoma 1.400 3.8e-04
osteosarcoma -2.136 6.7e-08
ovarian cancer -1.600 1.0e-09
pediatric high grade glioma 1.400 7.6e-05
ulcerative colitis -1.312 2.9e-02

Gene RIF (3)

AA Sequence

MAAARDPPEVSLREATQRKLRRFSELRGKLVARGEFWDIVAITAADEKQELAYNQQLSEKLKRKELPLGV      1 - 70
QYHVFVDPAGAKIGNGGSTLCALQCLEKLYGDKWNSFTILLIHSGGYSQRLPNASALGKIFTALPLGNPI     71 - 140
YQMLELKLAMYIDFPLNMNPGILVTCADDIELYSIGEFEFIRFDKPGFTALAHPSSLTIGTTHGVFVLDP    141 - 210
FDDLKHRDLEYRSCHRFLHKPSIEKMYQFNAVCRPGNFCQQDFAGGDIADLKLDSDYVYTDSLFYMDHKS    211 - 280
AKMLLAFYEKIGTLSCEIDAYGDFLQALGPGATVEYTRNTSNVIKEESELVEMRQRIFHLLKGTSLNVVV    281 - 350
LNNSKFYHIGTTEEYLFYFTSDNSLKSELGLQSITFSIFPDIPECSGKTSCIIQSILDSRCSVAPGSVVE    351 - 420
YSRLGPDVSVGENCIISGSYILTKAALPAHSFVCSLSLKMNRCLKYATMAFGVQDNLKKSVKTLSDIKLL    421 - 490
QFFGVCFLSCLDVWNLKVTEELFSGNKTCLSLWTARIFPVCSSLSDSVITSLKMLNAVKNKSAFSLNSYK    491 - 560
LLSIEEMLIYKDVEDMITYREQIFLEISLKSSLM                                        561 - 594
//

Text Mined References (11)

PMID Year Title