Property Summary

NCBI Gene PubMed Count 9
PubMed Score 11.89
PubTator Score 8.60

Knowledge Summary


No data available


  Disease Sources (4)

Disease Target Count
Renal Cell Carcinoma 199
Disease Target Count P-value
ovarian cancer 8492 1.04080745518175E-9
ependymoma 2514 1.32410210737113E-9
osteosarcoma 7933 6.6667715354376E-8
atypical teratoid/rhabdoid tumor 1095 1.48435614542534E-6
glioblastoma 5572 1.09033653028171E-5
pediatric high grade glioma 2712 7.62625392273349E-5
pilocytic astrocytoma 3086 2.62358080830359E-4
hepatocellular carcinoma 550 3.8171704619284E-4
ulcerative colitis 2087 0.0289606347228987
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Osteonecrosis 25 3.347 1.7
Myocarditis 17 3.003 1.5


  Differential Expression (9)

Disease log2 FC p
hepatocellular carcinoma 1.400 0.000
osteosarcoma -2.136 0.000
ependymoma 1.400 0.000
glioblastoma 1.300 0.000
atypical teratoid/rhabdoid tumor 1.500 0.000
ulcerative colitis -1.312 0.029
pediatric high grade glioma 1.400 0.000
pilocytic astrocytoma 1.200 0.000
ovarian cancer -1.600 0.000


Accession O14772 A6NMH3 B4DRX2 B4E2Y7 E9PNQ2 Q8N5J7
Symbols GFPP


  Ortholog (7)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (3)

16582493 A complete native data set has been collected as a first step in determining the three-dimensional structure of this enzyme.
16185085 identified five amino acid residues that are critical for catalysis.
16086588 the nature of the purine base is the major determinant in substrate specificity, followed by the nature of the hexose-1-P, and finally by the ribose moiety. Binding is enthalpy-driven and does not involve proton transfer

AA Sequence

LLSIEEMLIYKDVEDMITYREQIFLEISLKSSLM                                        561 - 594

Text Mined References (11)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16582493 2006 Purification, crystallization and preliminary X-ray characterization of the human GTP fucose pyrophosphorylase.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16185085 2005 Identification of catalytic amino acids in the human GTP fucose pyrophosphorylase active site.
16086588 2005 Substrate discrimination by the human GTP fucose pyrophosphorylase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9804772 1998 GDP-L-fucose pyrophosphorylase. Purification, cDNA cloning, and properties of the enzyme.