Property Summary

NCBI Gene PubMed Count 121
Grant Count 102
R01 Count 65
Funding $9,849,412.02
PubMed Score 144.75
PubTator Score 128.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Multiple myeloma 1.145 0.006
ependymoma 1.300 0.007
oligodendroglioma 1.200 0.006
psoriasis 1.100 0.000
osteosarcoma -1.511 0.000
medulloblastoma, large-cell 1.200 0.000
non-small cell lung cancer 1.104 0.000
lung cancer 1.900 0.000
group 3 medulloblastoma 1.100 0.001
non primary Sjogren syndrome sicca 1.400 0.019
spina bifida -1.702 0.036
ovarian cancer 2.000 0.001

Synonym

Accession O14744 A8MTP3 A8MZ91 B4DX49 B4DY30 B5BU10 D3DS33 E2QRE7 Q6IBR1 Q9UKH1
Symbols JBP1
SKB1
IBP72
SKB1Hs
HRMT1L5

Gene

PANTHER Protein Class (1)

PDB

4GQB   5FA5   4X60   4X61   4X63   5C9Z   5EMJ   5EMK   5EML   5EMM  

Gene RIF (85)

PMID Text
26912361 methylthioadenosine accumulation in 5-methylthioadenosine phosphorylase-deleted cancers creates a hypomorphic PRMT5 state that is selectively sensitized toward further PRMT5 inhibition.
26912360 these findings reveal PRMT5 as a potential vulnerability across multiple cancer lineages augmented by a common "passenger" genomic alteration.
26763441 PRMT5 gene is silencing gene expression by histone arginine methylation in keratinocytes.
26759235 PRMT5-induced methylation prevented phosphorylation of SREBP1a on S430 by GSK3beta
26729154 PRMT5 expression was upregulated during HTLV-1-mediated T-cell transformation.
26708443 Our results indicate that PRMT5 is a marker of poor prognosis in NPC patients. PRMT5 promoted the radioresistance of NPC cells via targeting FGFR3, at least partly if not totally.
26658161 Data show that the E3 ubiquitin ligase CHIP interacts with protein arginine methyltransferase-5 (PRMT5) both in vivo and in vitro.
26597461 UHRF1 could form a complex with PRMT5 to contribute to the endometrial carcinogenesis.
26563484 Data show that Omomyc protein co-localized with proto-oncogene protein c-myc (c-Myc), protein arginine methyltransferase 5 (PRMT5) and histone H4 H4R3me2s-enriched chromatin domains.
26554819 arginine residues within the third intracellular loop of the D2 dopamine receptor were methylated by protein arginine methyltransferase 5 (PRMT5)
More...

AA Sequence

MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSD      1 - 70
LLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTN     71 - 140
HIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGA    141 - 210
DLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSY    211 - 280
LQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVP    281 - 350
EEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDM    351 - 420
REWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREK    421 - 490
DRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLY    491 - 560
QDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTG    561 - 630
RSYTIGL                                                                   631 - 637
//

Text Mined References (130)

PMID Year Title
26912361 2016 Disordered methionine metabolism in MTAP/CDKN2A-deleted cancers leads to dependence on PRMT5.
26912360 2016 MTAP deletion confers enhanced dependency on the PRMT5 arginine methyltransferase in cancer cells.
26763441 2016 MEP50/PRMT5 Reduces Gene Expression by Histone Arginine Methylation and this Is Reversed by PKC?/p38? Signaling.
26759235 2016 Arginine Methylation of SREBP1a via PRMT5 Promotes De Novo Lipogenesis and Tumor Growth.
26729154 2015 PRMT5 Is Upregulated in HTLV-1-Mediated T-Cell Transformation and Selective Inhibition Alters Viral Gene Expression and Infected Cell Survival.
26708443 2016 Protein N-arginine methyltransferase 5 promotes the tumor progression and radioresistance of nasopharyngeal carcinoma.
26700805 2016 SMN and symmetric arginine dimethylation of RNA polymerase II C-terminal domain control termination.
26658161 2016 The E3 ubiquitin ligase CHIP mediates ubiquitination and proteasomal degradation of PRMT5.
26597461 2016 Methylation of tumor suppressor gene CDH13 and SHP1 promoters and their epigenetic regulation by the UHRF1/PRMT5 complex in endometrial carcinoma.
26563484 2015 Myc and Omomyc functionally associate with the Protein Arginine Methyltransferase 5 (PRMT5) in glioblastoma cells.
More...