Property Summary

Ligand Count 4
NCBI Gene PubMed Count 144
PubMed Score 171.05
PubTator Score 128.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Cancer 2499 3.826 1.9

Expression

  Differential Expression (12)

Disease log2 FC p
ependymoma 1.300 6.7e-03
group 3 medulloblastoma 1.100 5.4e-04
lung cancer 1.800 2.9e-04
medulloblastoma, large-cell 1.200 1.6e-04
Multiple myeloma 1.145 5.9e-03
non primary Sjogren syndrome sicca 1.400 1.9e-02
non-small cell lung cancer 1.104 1.1e-17
oligodendroglioma 1.200 5.6e-03
osteosarcoma -1.511 3.2e-05
ovarian cancer 2.000 1.2e-03
psoriasis 1.100 4.4e-04
spina bifida -1.702 3.6e-02

PDB (10)

Gene RIF (105)

AA Sequence

MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSD      1 - 70
LLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTN     71 - 140
HIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGA    141 - 210
DLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSY    211 - 280
LQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVP    281 - 350
EEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDM    351 - 420
REWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREK    421 - 490
DRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLY    491 - 560
QDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTG    561 - 630
RSYTIGL                                                                   631 - 637
//

Text Mined References (153)

PMID Year Title