Property Summary

NCBI Gene PubMed Count 21
PubMed Score 21.82
PubTator Score 12.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.324 0.000
lung cancer 1.500 0.020

Synonym

Accession O14681 A8K7D6 B4DKL6 Q9BUQ1
Symbols EPG4
PIG8
TP53I8

Gene

Gene RIF (7)

PMID Text
26342551 Low EI24 and high IGF-1R expressions in lung cancer patients.
24821838 Ei24 can bind specifically to IMPbeta1 and IMPalpha2 to impede their normal role in nuclear import.
24280371 Findings establish EI24 as a critical suppressor of tumor progression.
24014029 Ei24 is a novel E2F1 target gene contributing to the survival of p53-deficient cells upon UVC irradiation and thus may have a potential significance as a therapeutic target of certain chemotherapy for treating p53-deficient tumors.
21803008 LOH11CR2A, PIG8 and CHEK1 are candidate tumor suppressor genes associated with breast carcinoma and have significant clinical as well as prognostic importance.
21154811 our data suggest that inactivation of EI24 and CHEK1 through two independent mechanisms contributes to the development of CACX.
17981155 identify the EI24/PIG8 status as a potentially new prognostic marker of chemotherapy responsiveness

AA Sequence

MADSVKTFLQDLARGIKDSIWGICTISKLDARIQQKREEQRRRRASSVLAQRRAQSIERKQESEPRIVSR      1 - 70
IFQCCAWNGGVFWFSLLLFYRVFIPVLQSVTARIIGDPSLHGDVWSWLEFFLTSIFSALWVLPLFVLSKV     71 - 140
VNAIWFQDIADLAFEVSGRKPHPFPSVSKIIADMLFNLLLQALFLIQGMFVSLFPIHLVGQLVSLLHMSL    141 - 210
LYSLYCFEYRWFNKGIEMHQRLSNIERNWPYYFGFGLPLAFLTAMQSSYIISGCLFSILFPLFIISANEA    211 - 280
KTPGKAYLFQLRLFSLVVFLSNRLFHKTVYLQSALSSSTSAEKFPSPHPSPAKLKATAGH              281 - 340
//

Text Mined References (31)

PMID Year Title
26342551 2015 Reduced expression of EI24 confers resistance to gefitinib through IGF-1R signaling in PC9 NSCLC cells.
24821838 2014 The p53-induced factor Ei24 inhibits nuclear import through an importin ?-binding-like domain.
24280371 2013 EI24 regulates epithelial-to-mesenchymal transition and tumor progression by suppressing TRAF2-mediated NF-?B activity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24014029 2013 Ei24, a novel E2F target gene, affects p53-independent cell death upon ultraviolet C irradiation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21803008 2011 Frequent alterations of LOH11CR2A, PIG8 and CHEK1 genes at chromosomal 11q24.1-24.2 region in breast carcinoma: clinical and prognostic implications.
21269460 2011 Initial characterization of the human central proteome.
21154811 2011 Inactivation of CHEK1 and EI24 is associated with the development of invasive cervical carcinoma: clinical and prognostic implications.
More...