Property Summary

NCBI Gene PubMed Count 23
PubMed Score 23.38
PubTator Score 12.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Prostatic Neoplasms 495 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 5.0e-04
lung cancer 4740 2.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.500 2.0e-02
osteosarcoma 1.324 5.0e-04

Gene RIF (9)

AA Sequence

MADSVKTFLQDLARGIKDSIWGICTISKLDARIQQKREEQRRRRASSVLAQRRAQSIERKQESEPRIVSR      1 - 70
IFQCCAWNGGVFWFSLLLFYRVFIPVLQSVTARIIGDPSLHGDVWSWLEFFLTSIFSALWVLPLFVLSKV     71 - 140
VNAIWFQDIADLAFEVSGRKPHPFPSVSKIIADMLFNLLLQALFLIQGMFVSLFPIHLVGQLVSLLHMSL    141 - 210
LYSLYCFEYRWFNKGIEMHQRLSNIERNWPYYFGFGLPLAFLTAMQSSYIISGCLFSILFPLFIISANEA    211 - 280
KTPGKAYLFQLRLFSLVVFLSNRLFHKTVYLQSALSSSTSAEKFPSPHPSPAKLKATAGH              281 - 340
//

Text Mined References (33)

PMID Year Title