Property Summary

NCBI Gene PubMed Count 15
PubMed Score 113.47
PubTator Score 60.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Gene RIF (4)

AA Sequence

MLRAGWLRGAAALALLLAARVVAAFEPITVGLAIGAASAITGYLSYNDIYCRFAECCREERPLNASALKL      1 - 70
DLEEKLFGQHLATEVIFKALTGFRNNKNPKKPLTLSLHGWAGTGKNFVSQIVAENLHPKGLKSNFVHLFV     71 - 140
STLHFPHEQKIKLYQDQLQKWIRGNVSACANSVFIFDEMDKLHPGIIDAIKPFLDYYEQVDGVSYRKAIF    141 - 210
IFLSNAGGDLITKTALDFWRAGRKREDIQLKDLEPVLSVGVFNNKHSGLWHSGLIDKNLIDYFIPFLPLE    211 - 280
YRHVKMCVRAEMRARGSAIDEDIVTRVAEEMTFFPRDEKIYSDKGCKTVQSRLDFH                  281 - 336
//

Text Mined References (16)

PMID Year Title