Property Summary

NCBI Gene PubMed Count 34
Grant Count 14
R01 Count 11
Funding $890,806.42
PubMed Score 0.00
PubTator Score 43.03

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (24)

PMID Text
25631074 Cellular biotinylated insulin receptor substrate 4 (IRS4) is incorporated into HIV-1 Gag virus-like particles
25100728 The association of IRS4 with SSH1 contributes to localized activation of cofilin in membrane protrusions.
24039912 Overexpression of IRS4 in U2OS cells activates PI3K signalling.
22167131 This study clearly demonstrates associations between body mass index and IRS-4 variants in schizophrenia patients, but not in healthy controls, pointing to a possible involvement of IRS-4 in the control of body weight in schizophrenia.
21852217 We genotyped single-nucleotide polymorphisms of IGF1, IGF2, IGF1R, IGF2R, IGFBP1, IGFBP3, IGFBP5, IRS1, IRS2, and IRS in pancreatic cancer patients
21517825 Study for the first time identified IRS4 mutations in T-ALL.
21407155 IRS-4 gene is not of importance for aetiology of the vast majority of schizophrenia cases, but a single patient with schizophrenia and a mutation in IRS-4 points to that the insulin signalling system is of interest in the search for schizophrenia genes
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20416304 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20340132 The t(X;6) in subungual exostosis results in transcriptional deregulation of the gene for insulin receptor substrate 4.
More...

AA Sequence

MASCSFTRDQATRRLRGAAAAAAAALAAVVTTPLLSSGTPTALIGTGSSCPGAMWLSTATGSRSDSESEE      1 - 70
EDLPVGEEVCKRGYLRKQKHGHRRYFVLKLETADAPARLEYYENARKFRHSVRAAAAAAAAAASGAAIPP     71 - 140
LIPPRRVITLYQCFSVSQRADARYRHLIALFTQDEYFAMVAENESEQESWYLLLSRLILESKRRRCGTLG    141 - 210
AQPDGEPAALAAAAAAEPPFYKDVWQVIVKPRGLGHRKELSGVFRLCLTDEEVVFVRLNTEVASVVVQLL    211 - 280
SIRRCGHSEQYFFLEVGRSTVIGPGELWMQVDDCVVAQNMHELFLEKMRALCADEYRARCRSYSISIGAH    281 - 350
LLTLLSARRHLGLVPLEPGGWLRRSRFEQFCHLRAIGDGEDEMLFTRRFVTPSEPVAHSRRGRLHLPRGR    351 - 420
RSRRAVSVPASFFRRLAPSPARPRHPAEAPNNGARLSSEVSGSGSGNFGEEGNPQGKEDQEGSGGDYMPM    421 - 490
NNWGSGNGRGSGGGQGSNGQGSSSHSSGGNQCSGEGQGSRGGQGSNGQGSGGNQCSRDGQGTAGGHGSGG    491 - 560
GQRPGGGHGSGGGQGPGDGHGSGGGKNSGGGKGSGSGKGSDGDGERGKSLKKRSYFGKLTQSKQQQMPPP    561 - 630
PPPPPPPPPAGGTGGKGKSGGRFRLYFCVDRGATKECKEAKEVKDAEIPEGAARGPHRARAFDEDEDDPY    631 - 700
VPMRPGVATPLVSSSDYMPMAPQNVSASKKRHSRSPFEDSRGYMMMFPRVSPPPAPSPPKAPDTNKEDDS    701 - 770
KDNDSESDYMFMAPGAGAIPKNPRNPQGGSSSKSWSSYFSLPNPFRSSPLGQNDNSEYVPMLPGKFLGRG    771 - 840
LDKEVSYNWDPKDAASKPSGEGSFSKPGDGGSPSKPSDHEPPKNKAKRPNRLSFITKGYKIKPKPQKPTH    841 - 910
EQREADSSSDYVNMDFTKRESNTPAPSTQGLPDSWGIIAEPRQSAFSNYVNVEFGVPFPNPANDLSDLLR    911 - 980
AIPRANPLSLDSARWPLPPLPLSATGSNAIEEEGDYIEVIFNSAMTPAMALADSAIRYDAETGRIYVVDP    981 - 1050
FSECCMDISLSPSRCSEPPPVARLLQEEEQERRRPQSRSQSFFAAARAAVSAFPTDSLERDLSPSSAPAV   1051 - 1120
ASAAEPTLALSQVVAAASALAAAPGIGAAAAAAGFDSASARWFQPVANAADAEAVRGAQDVAGGSNPGAH   1121 - 1190
NPSANLARGDNQAGGAAAAAAAPEPPPRSRRVPRPPEREDSDNDDDTHVRMDFARRDNQFDSPKRGR      1191 - 1257
//

Text Mined References (38)

PMID Year Title
25100728 2014 Insulin receptor substrate-4 binds to Slingshot-1 phosphatase and promotes cofilin dephosphorylation.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24039912 2013 Effect of IRS4 levels on PI 3-kinase signalling.
22167131 2011 Association between body mass index and insulin receptor substrate-4 (IRS-4) gene polymorphisms in patients with schizophrenia.
21852217 2012 Insulin-like growth factor axis gene polymorphisms modify risk of pancreatic cancer.
21517825 2011 The insulin receptor substrate 4 gene (IRS4) is mutated in paediatric T-cell acute lymphoblastic leukaemia.
21407155 2011 The insulin receptor substrate-4 (IRS-4) gene and schizophrenia: no evidence for a main genetic factor, however one report of a single schizophrenia patient with a mutation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20416304 2010 Insulin-like growth factor axis gene polymorphisms and clinical outcomes in pancreatic cancer.
20340132 2011 The t(X;6) in subungual exostosis results in transcriptional deregulation of the gene for insulin receptor substrate 4.
More...