Property Summary

NCBI Gene PubMed Count 18
Grant Count 6
R01 Count 1
Funding $273,021.25
PubMed Score 30.87
PubTator Score 15.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Synonym

Accession O14607 A8K9Z3 E1U199 E1U1A0 F5H4V7 F8W8R7 O14608
Symbols UTY1
KDM6C
KDM6AL

Gene

UTY

PANTHER Protein Class (1)

PDB

3ZLI   3ZPO   4UF0   5A1L   5FXV   5FXW   5FXX   5FXZ   5FY0   5FY1   5FY7   5FYM  

Gene RIF (3)

PMID Text
24798337 UTY(KDM6C) is an active lysine demethylases and catalyzes demethylation of H3K27 peptides.
18976975 Knockdown of ubiquitously transcribed tetratricopeptide repeat gene, Y-linked (UTY) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18511697 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKSCAVSLTTAAVAFGDEAKKMAEGKASRESEEESVSLTVEEREALGGMDSRLFGFVRLHEDGARTKTLL      1 - 70
GKAVRCYESLILKAEGKVESDFFCQLGHFNLLLEDYSKALSAYQRYYSLQADYWKNAAFLYGLGLVYFYY     71 - 140
NAFHWAIKAFQDVLYVDPSFCRAKEIHLRLGLMFKVNTDYKSSLKHFQLALIDCNPCTLSNAEIQFHIAH    141 - 210
LYETQRKYHSAKEAYEQLLQTENLPAQVKATVLQQLGWMHHNMDLVGDKATKESYAIQYLQKSLEADPNS    211 - 280
GQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAA    281 - 350
AWMDLGTLYESCNQPQDAIKCYLNAARSKRCSNTSTLAARIKFLQNGSDNWNGGQSLSHHPVQQVYSLCL    351 - 420
TPQKLQHLEQLRANRDNLNPAQKHQLEQLESQFVLMQQMRHKEVAQVRTTGIHNGAITDSSLPTNSVSNR    421 - 490
QPHGALTRVSSVSQPGVRPACVEKLLSSGAFSAGCIPCGTSKILGSTDTILLGSNCIAGSESNGNVPYLQ    491 - 560
QNTHTLPHNHTDLNSSTEEPWRKQLSNSAQGLHKSQSSCLSGPNEEQPLFSTGSAQYHQATSTGIKKANE    561 - 630
HLTLPSNSVPQGDADSHLSCHTATSGGQQGIMFTKESKPSKNRSLVPETSRHTGDTSNGCADVKGLSNHV    631 - 700
HQLIADAVSSPNHGDSPNLLIADNPQLSALLIGKANGNVGTGTCDKVNNIHPAVHTKTDHSVASSPSSAI    701 - 770
STATPSPKSTEQRSINSVTSLNSPHSGLHTVNGEGLGKSQSSTKVDLPLASHRSTSQILPSMSVSICPSS    771 - 840
TEVLKACRNPGKNGLSNSCILLDKCPPPRPPTSPYPPLPKDKLNPPTPSIYLENKRDAFFPPLHQFCTNP    841 - 910
KNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWRCESNRSHTTIA    911 - 980
KYAQYQASSFQESLREENEKRTQHKDHSDNESTSSENSGRRRKGPFKTIKFGTNIDLSDNKKWKLQLHEL    981 - 1050
TKLPAFARVVSAGNLLTHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEDY   1051 - 1120
WGVLNDFCEKNNLNFLMSSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAVGWCNNIAWNVGP   1121 - 1190
LTACQYKLAVERYEWNKLKSVKSPVPMVHLSWNMARNIKVSDPKLFEMIKYCLLKILKQYQTLREALVAA   1191 - 1260
GKEVIWHGRTNDEPAHYCSICEVEVFNLLFVTNESNTQKTYIVHCHDCARKTSKSLENFVVLEQYKMEDL   1261 - 1330
IQVYDQFTLALSLSSSS                                                        1331 - 1347
//

Text Mined References (19)

PMID Year Title
24798337 2014 Human UTY(KDM6C) is a male-specific N?-methyl lysyl demethylase.
21329462 2011 Huge splicing frequency in human Y chromosomal UTY gene.
18511697 2008 Genetic variants of Y chromosome are associated with a protective lipid profile in black men.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17452356 2007 Non-EST-based prediction of novel alternatively spliced cassette exons with cell signaling function in Caenorhabditis elegans and human.
15758204 2005 Positive and negative selection on mammalian Y chromosomes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14660691 2004 Sex differences in structure and expression of the sex chromosome genes CHD1Z and CHD1W in zebra finches.
12815422 2003 The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
More...