Property Summary

NCBI Gene PubMed Count 6
PubMed Score 43.01
PubTator Score 1.00

Knowledge Summary

Patent

No data available

AA Sequence

MGATGLGFLLSWRQDNLNGTDCQGCNILYFSETTGSMCSELSLNRGLEARRKKDLKDSFLWRYGKVGCIS      1 - 70
LPLREMTAWINPPQISEIFQGYHQRVHGADALSLQTNSLRSRLSSQCLGQSFLLRTLERGRGFRALGDIC     71 - 140
GHVHEED                                                                   141 - 147
//

Text Mined References (7)

PMID Year Title