Property Summary

NCBI Gene PubMed Count 6
Grant Count 4
R01 Count 4
Funding $511,724.5
PubMed Score 36.27
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Synonym

Accession O14603 B7ZLM1 Q14D09
Symbols PRY1
PTPN13LY

Gene

PRY

 Compartment GO Term (1)

AA Sequence

MGATGLGFLLSWRQDNLNGTDCQGCNILYFSETTGSMCSELSLNRGLEARRKKDLKDSFLWRYGKVGCIS      1 - 70
LPLREMTAWINPPQISEIFQGYHQRVHGADALSLQTNSLRSRLSSQCLGQSFLLRTLERGRGFRALGDIC     71 - 140
GHVHEED                                                                   141 - 147
//

Text Mined References (7)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15177557 2004 A family of human Y chromosomes has dispersed throughout northern Eurasia despite a 1.8-Mb deletion in the azoospermia factor c region.
14665702 2004 Expression pattern of the Y-linked PRY gene suggests a function in apoptosis but not in spermatogenesis.
12815422 2003 The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11420382 2001 Characterization of the genomic organization, localization and expression of four PRY genes (PRY1, PRY2, PRY3 and PRY4).
9381176 1997 Functional coherence of the human Y chromosome.