Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.04

Knowledge Summary

Patent (471)

AA Sequence

MEPENDTGISEFVLLGLSEEPELQPFLFGLFLSMYLVTVLGNLLIILATISDSHLHTPMYFFLSNLSFAD      1 - 70
ICFISTTIPKMLINIQTQSRVITYAGCITQMCFFVLFGGLDSLLLAVMAYDRFVAICHPLHYTVIMNPRL     71 - 140
CGLLVLASWMIAALNSLSQSLMVLWLSFCTDLEIPHFFCELNQVIHLACSDTFLNDMGMYFAAGLLAGGP    141 - 210
LVGILCSYSKIVSSIRAISSAQGKYKAFSTCASHLSVVSLFCCTGLGVYLTSAATHNSHTSATASVMYTV    211 - 280
ATPMLNPFIYSLRNKDIKRALKMSFRGKQ                                             281 - 309
//

Text Mined References (6)

PMID Year Title