Property Summary

NCBI Gene PubMed Count 27
PubMed Score 40.66
PubTator Score 1295.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Rheumatoid Arthritis -1.600 0.007
Multiple myeloma 1.168 0.006
osteosarcoma 1.284 0.000
pancreatic ductal adenocarcinoma liver m... -1.308 0.012
diabetes mellitus -1.100 0.003
posterior fossa group B ependymoma 1.100 0.000
lung adenocarcinoma 1.100 0.001
ovarian cancer 1.600 0.000

Synonym

Accession O14579 A6NE29 A6NKA3 O76097 Q6IBB8 Q9UGP6
Symbols epsilon-COP

Gene

Gene RIF (3)

PMID Text
20237496 Observational study of gene-disease association. (HuGE Navigator)
19632984 Data show that iPLA(1)gamma is a novel membrane transport factor that contributes to a specific Golgi-to-ER retrograde pathway distinct from presently characterized COPI- and Rab6-dependent pathways.
17721809 Ubiquitylation of epsilon-COP by PIRH2; overexpression of the wild type of PIRH2 in prostate cancer cells causes downregulation of the secretion of prostate-specific antigen.

AA Sequence

MAPPAPGPASGGSGEVDELFDVKNAFYIGSYQQCINEAQRVKLSSPERDVERDVFLYRAYLAQRKFGVVL      1 - 70
DEIKPSSAPELQAVRMFADYLAHESRRDSIVAELDREMSRSVDVTNTTFLLMAASIYLHDQNPDAALRAL     71 - 140
HQGDSLECTAMTVQILLKLDRLDLARKELKRMQDLDEDATLTQLATAWVSLATGGEKLQDAYYIFQEMAD    141 - 210
KCSPTLLLLNGQAACHMAQGRWEAAEGLLQEALDKDSGYPETLVNLIVLSQHLGKPPEVTNRYLSQLKDA    211 - 280
HRSHPFIKEYQAKENDFDRLVLQYAPSA                                              281 - 308
//

Text Mined References (33)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19632984 2009 Intracellular phospholipase A1gamma (iPLA1gamma) is a novel factor involved in coat protein complex I- and Rab6-independent retrograde transport between the endoplasmic reticulum and the Golgi complex.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17721809 2008 Ubiquitylation of epsilon-COP by PIRH2 and regulation of the secretion of PSA.
More...