Property Summary

NCBI Gene PubMed Count 27
PubMed Score 43.01
PubTator Score 1295.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
diabetes mellitus -1.100 3.3e-03
lung adenocarcinoma 1.100 1.1e-03
Multiple myeloma 1.168 5.9e-03
osteosarcoma 1.284 4.5e-07
ovarian cancer 1.600 2.3e-05
pancreatic ductal adenocarcinoma liver m... -1.308 1.2e-02
posterior fossa group B ependymoma 1.100 6.5e-08
Rheumatoid arthritis -1.600 7.4e-03

Protein-protein Interaction (2)

Gene RIF (3)

AA Sequence

MAPPAPGPASGGSGEVDELFDVKNAFYIGSYQQCINEAQRVKLSSPERDVERDVFLYRAYLAQRKFGVVL      1 - 70
DEIKPSSAPELQAVRMFADYLAHESRRDSIVAELDREMSRSVDVTNTTFLLMAASIYLHDQNPDAALRAL     71 - 140
HQGDSLECTAMTVQILLKLDRLDLARKELKRMQDLDEDATLTQLATAWVSLATGGEKLQDAYYIFQEMAD    141 - 210
KCSPTLLLLNGQAACHMAQGRWEAAEGLLQEALDKDSGYPETLVNLIVLSQHLGKPPEVTNRYLSQLKDA    211 - 280
HRSHPFIKEYQAKENDFDRLVLQYAPSA                                              281 - 308
//

Text Mined References (33)

PMID Year Title